DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and Tmem41a

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_079969.1 Gene:Tmem41a MGIID:1913914 Length:264 Species:Mus musculus

Alignment Length:242 Identity:89/243 (37%)
Similarity:141/243 (58%) Gaps:3/243 (1%)


  Fly    82 LVIVAGIFVASLVTMCYVYAIFPELNAS---EKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMF 143
            |::|.|....:|..:.....:.|.|.|:   |.:.|..|.|:.:.:.|::||..|:..:...|..
Mouse     7 LLLVFGGCTFALYLLSTRLPLGPRLAAAGEPEGRSLWFPSDLAELRELSEVLREYRKEHQAYVFL 71

  Fly   144 GVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWP 208
            ....||::.|.||||||.||::|.|.|:...:.|.|.|..:::|||.||.||:|.|::|:..::|
Mouse    72 LFCSAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSLFGKQLVISYFP 136

  Fly   209 KKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAI 273
            .|.:...|.|||.|:|||.::||||:.|:.||||:||::|::.:|:..|......|:.|.:.|.:
Mouse   137 DKVALLQKKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICV 201

  Fly   274 QAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKFKHKKEA 320
            |.|..|..:||....|||.::..|:|.|..:|:||.|..||..|:.|
Mouse   202 QTGSILSTLTSLDALFSWETVLKLLAIALVALVPGTLIKKFSQKRLA 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 50/119 (42%)
Tmem41aNP_079969.1 SNARE_assoc 85..205 CDD:286425 51/120 (43%)
VTT domain. {ECO:0000250|UniProtKB:Q96HV5} 96..207 44/111 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128091
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.