DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and tmem41b

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001073456.1 Gene:tmem41b ZFINID:ZDB-GENE-061215-138 Length:282 Species:Danio rerio

Alignment Length:265 Identity:126/266 (47%)
Similarity:181/266 (68%) Gaps:0/266 (0%)


  Fly    55 QQQQQQQQATPQKQAMSADEKKATKKSLVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRD 119
            :|:.:..:.||..:...:....:.:.|::::..||..|...|..|:..||:|:..|::.:|||:|
Zfish    18 EQEPRPSKETPVPKGAQSPGGASARMSILLLVVIFACSACVMYLVFRNFPQLSEDEREKIKIPKD 82

  Fly   120 IQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCS 184
            ::|||.|..||.:|||.||.:|:......|:||||||||||:|||||.|:||.||:||||:|.||
Zfish    83 MEDAKALGTVLSKYKDTYYTQVLLAYFATYIFLQTFAIPGSIFLSILSGYLYPFPLALFLVCLCS 147

  Fly   185 ALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPV 249
            .|||:.||.||.||||.::..:..::..:||:.|:::|:.|.||::|||:||.|||||||:.|||
Zfish   148 GLGASFCYMLSYLVGRPMVYKYLTERAQKWSQQVDKHREHLINYIIFLRITPFLPNWFINITSPV 212

  Fly   250 IGVPLHIFALGTFCGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKF 314
            |.|||.:|.||||.||||||.:||.||.||.|:|::.||.||.|:.:|...|..|:||...:.|.
Zfish   213 INVPLGVFFLGTFLGVAPPSFVAINAGTTLYKLTTAGEAVSWNSLLVLGVLAVVSILPVCFQKKL 277

  Fly   315 KHKKE 319
            :.|.|
Zfish   278 QQKLE 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 72/119 (61%)
tmem41bNP_001073456.1 SNARE_assoc 120..239 CDD:286425 72/119 (61%)
VTT domain, required for its function in autophagy. {ECO:0000250|UniProtKB:Q5BJD5} 131..242 65/111 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C233185366
eggNOG 1 0.900 E1_COG0398
Hieranoid 1 1.000
Homologene 1 1.000 H42740
Inparanoid 1 1.050 271 1.000 Inparanoid score I2916
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006292
OrthoInspector 1 1.000 T1054329
orthoMCL 1 0.900 OOG5_128091
Panther 1 1.100 LDO PTHR43220
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2849
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.