DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and tmem41aa

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001018601.1 Gene:tmem41aa ZFINID:ZDB-GENE-050522-53 Length:281 Species:Danio rerio

Alignment Length:262 Identity:92/263 (35%)
Similarity:141/263 (54%) Gaps:31/263 (12%)


  Fly    80 KSLV-IVAGIFVASLVTMCYVYAIF------PELNASEKQ--------------------HLKIP 117
            :||| :||.|..|:.    |:|::.      |:|:....:                    .||.|
Zfish     2 RSLVGLVAVIVTATF----YLYSLSVFLPPGPQLHKQSHEGETTDAKDGDEPSEMETASSRLKFP 62

  Fly   118 RDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICF 182
            .|:.:.|.:|::|..||..:...|:.....||::.|.||||||.||:||.|.|:.....|.|.|.
Zfish    63 SDLDELKEMAELLQFYKTEHTGYVLLLFCSAYLYKQAFAIPGSSFLNILAGALFGTWFGLLLTCV 127

  Fly   183 CSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLAS 247
            .:.:|||||:.||...|:..|...:|.|.:...|.|||.|.|||.::||||..|:.||||:|:.|
Zfish   128 LTTVGATLCFLLSQAFGKHHIVKLFPDKVAMLQKKVEENRSSLFFFLLFLRFFPMSPNWFLNMTS 192

  Fly   248 PVIGVPLHIFALGTFCGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKN 312
            |::.:|:.:|.:..|.|:.|.:.|.:|.|..|.:::|..:.|||:.:..|:..||.:||||.|..
Zfish   193 PILNIPVTLFFMAVFIGLMPYNFICVQTGSMLSQISSLDDLFSWSVVLKLLLTACVALLPGALIR 257

  Fly   313 KF 314
            |:
Zfish   258 KY 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 51/119 (43%)
tmem41aaNP_001018601.1 SNARE_assoc 102..223 CDD:286425 52/121 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128091
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.