DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and tmem41ab

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_998248.1 Gene:tmem41ab ZFINID:ZDB-GENE-040426-2050 Length:278 Species:Danio rerio

Alignment Length:253 Identity:86/254 (34%)
Similarity:136/254 (54%) Gaps:24/254 (9%)


  Fly    88 IFVASLVTMCYVYAIF--------------PELNASEKQ----HLKIPRDIQDAKMLAKVLDRYK 134
            :.||:.....|:.:.|              ||....|.:    .||.|.|:::.:.||::|..||
Zfish     9 VLVAAATFYLYLLSAFLPPGPRAIRVHDTGPEHTDDEPEEKVLRLKFPSDLEELRELAELLKFYK 73

  Fly   135 DMY--YFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNL 197
            ..:  |..::|  ..||::.|:||||||.||::|.|.|:.....|.:.|..:.:|:|.||.||..
Zfish    74 TEHTGYVFILF--CSAYLYKQSFAIPGSSFLNMLSGALFGPLHGLIIACTLTTVGSTNCYLLSRT 136

  Fly   198 VGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTF 262
            .|:|.|...:|:|.:...:.|||.|.|||.::||||..|:.||||:|:.||::.:|:.||.....
Zfish   137 FGKRHIVRLFPEKVAMLQRMVEENRSSLFFFLLFLRFFPMTPNWFLNVTSPILNIPIPIFFFSIL 201

  Fly   263 CGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKFK--HKK 318
            .|:.|.:.|.:..|..|.::.|..:.|||.::..|:..||.:||||.|..::.  |.|
Zfish   202 IGLIPYNFICVHTGAVLSEINSLDDIFSWFTLLQLLLIACVALLPGALIRRYSKDHLK 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 47/119 (39%)
tmem41abNP_998248.1 SNARE_assoc 96..217 CDD:286425 48/121 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128091
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.