DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and Tmem41b

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001012358.1 Gene:Tmem41b / 361626 RGDID:1310870 Length:291 Species:Rattus norvegicus


Alignment Length:246 Identity:130/246 - (52%)
Similarity:175/246 - (71%) Gaps:0/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 EKKATKKSLVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYY 138
            |..:.:.||:|:..||..:...|..||..||:|:..|:.::|:|||:.|||.|.|||.:|||.:|
  Rat    46 EAGSARTSLLILVSIFSCAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFY 110

  Fly   139 FEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLI 203
            .:|:......|:||||||||||:|||||.||||.||:||||:|.||.|||:.||.||.||||.::
  Rat   111 VQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVV 175

  Fly   204 RHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPP 268
            ..:..:|..:||:.||.:|:.|.||::|||:||.|||||||:.||||.|||.:|.:|||.|||||
  Rat   176 YKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP 240

  Fly   269 SVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKFKHKKE 319
            |.:||:||.||.::|::.||.||.|:.|||..|..|:||.:.:.|.|.|.|
  Rat   241 SFVAIKAGTTLYQLTTAGEAVSWNSVFILMILALLSILPAIFQKKLKQKFE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 73/118 (62%)
Tmem41bNP_001012358.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
SNARE_assoc 129..248 CDD:401323 73/118 (62%)
VTT domain, required for its function in autophagy. /evidence=ECO:0000250|UniProtKB:Q5BJD5 140..251 66/110 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346739
Domainoid 1 1.000 166 1.000 Domainoid score I3794
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42740
Inparanoid 1 1.050 276 1.000 Inparanoid score I2877
OMA 1 1.010 - - QHG54676
OrthoDB 1 1.010 - - D1222755at2759
OrthoFinder 1 1.000 - - FOG0001464
OrthoInspector 1 1.000 - - oto96796
orthoMCL 1 0.900 - - OOG6_102890
Panther 1 1.100 - - LDO PTHR43220
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2798
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.