DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and Tmem41b

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001012358.1 Gene:Tmem41b RGDID:1310870 Length:291 Species:Rattus norvegicus

Alignment Length:246 Identity:130/247 (53%)
Similarity:175/247 (71%) Gaps:0/247 (0%)


  Fly    74 EKKATKKSLVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYY 138
            |..:.:.||:|:..||..:...|..||..||:|:..|:.::|:|||:.|||.|.|||.:|||.:|
  Rat    46 EAGSARTSLLILVSIFSCAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFY 110

  Fly   139 FEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLI 203
            .:|:......|:||||||||||:|||||.||||.||:||||:|.||.|||:.||.||.||||.::
  Rat   111 VQVLVAYFATYIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVV 175

  Fly   204 RHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPP 268
            ..:..:|..:||:.||.:|:.|.||::|||:||.|||||||:.||||.|||.:|.:|||.|||||
  Rat   176 YKYLTEKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP 240

  Fly   269 SVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKFKHKKE 319
            |.:||:||.||.::|::.||.||.|:.|||..|..|:||.:.:.|.|.|.|
  Rat   241 SFVAIKAGTTLYQLTTAGEAVSWNSVFILMILALLSILPAIFQKKLKQKFE 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 74/119 (62%)
Tmem41bNP_001012358.1 SNARE_assoc 129..248 CDD:286425 74/119 (62%)
VTT domain, required for its function in autophagy. {ECO:0000250|UniProtKB:Q5BJD5} 140..251 67/111 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C233187380
eggNOG 1 0.900 E1_COG0398
Hieranoid 1 1.000
Homologene 1 1.000 H42740
Inparanoid 1 1.050 276 1.000 Inparanoid score I2824
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006292
OrthoInspector 1 1.000 T1088723
orthoMCL 1 0.900 OOG5_128091
Panther 1 1.100 LDO PTHR43220
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.