DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and Y71A12C.2

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_493447.2 Gene:Y71A12C.2 WormBaseID:WBGene00013513 Length:253 Species:Caenorhabditis elegans

Alignment Length:233 Identity:75/234 (32%)
Similarity:127/234 (54%) Gaps:25/234 (11%)


  Fly    82 LVIVAGIFVASLVTMCYVYAIF-----PELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMY--YF 139
            |::|  .|.||||    :||::     ||    ..|..:.|||::..:.|:..|.:|::.:  |.
 Worm     7 LLLV--FFGASLV----LYAVWSYGPLPE----GAQRPRFPRDLEGLRELSSSLTKYEESHAAYT 61

  Fly   140 EVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIR 204
            .::|.  .||::.||||||||.|:::|.|.|:.....:.|:|..:|:||:||:.||.|....::.
 Worm    62 VLLFS--AAYLYKQTFAIPGSFFMNLLAGALFGTVRGVALVCSLNAVGASLCFCLSALFAAPIVD 124

  Fly   205 HFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPS 269
            .|...:.......|...||.|:.::|..|:.|..|:|.:|::||.:.|||...|...|.|:.|.:
 Worm   125 RFLKSRIESLRCLVNAERDRLWFFLLSARIFPFTPHWLLNISSPFLDVPLRYHASSVFVGLFPYN 189

  Fly   270 VIAIQAGKTLQKMTSSSEAFS-WT-----SMGILMACA 301
            ::.::||..|.::.|.|:.|. ||     |:.:|:..|
 Worm   190 LLCVRAGTVLAEVNSMSDVFDVWTLSELFSVSLLLLVA 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 39/119 (33%)
Y71A12C.2NP_493447.2 SNARE_assoc 50..197 CDD:294297 50/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128091
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.