DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and tag-175

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_495985.1 Gene:tag-175 WormBaseID:WBGene00006520 Length:246 Species:Caenorhabditis elegans

Alignment Length:245 Identity:123/246 (50%)
Similarity:175/246 (71%) Gaps:5/246 (2%)


  Fly    74 EKKATKKS---LVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAKVLDRYKD 135
            |.|:::.|   ||::  ||....|::..||:.|||::|.||.|||.||:::|||.|.:||.:||:
 Worm     2 ETKSSQTSHPWLVLL--IFATFAVSIFAVYSNFPEVSADEKVHLKYPRNLEDAKQLGRVLSKYKE 64

  Fly   136 MYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGR 200
            ..|..|:.||:|.|||||:||||||:||:||.|:|:.|.:|:.|:|.|||.||.:|||:|.|.||
 Worm    65 NNYSVVLCGVIVVYVFLQSFAIPGSIFLTILSGYLFPFYVAIVLVCSCSATGAAICYTISKLFGR 129

  Fly   201 RLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGV 265
            ..:...:|::.::|...:.::||...|||:|||:|||:|||.||:||||:.|||..|..|||.||
 Worm   130 SFVLQKFPERIAKWQDDLSKHRDDFLNYMIFLRVTPIVPNWLINIASPVLDVPLAPFFWGTFLGV 194

  Fly   266 APPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKFK 315
            ||||.:.||||.||::::.:|.|:||:|:.:|...|..||.|.|||.|.|
 Worm   195 APPSFLYIQAGSTLEQLSHTSVAWSWSSIVLLTGSAILSLAPILLKKKLK 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 64/119 (54%)
tag-175NP_495985.1 SNARE_assoc 86..206 CDD:286425 65/120 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C233183944
eggNOG 1 0.900 E1_COG0398
Hieranoid 1 1.000
Homologene 1 1.000 H42740
Inparanoid 1 1.050 249 1.000 Inparanoid score I1999
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006292
OrthoInspector 1 1.000 T475818
orthoMCL 1 0.900 OOG5_128091
Panther 1 1.100 LDO PTHR43220
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2849
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.