DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and bus-19

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001041162.1 Gene:bus-19 WormBaseID:WBGene00011590 Length:259 Species:Caenorhabditis elegans

Alignment Length:226 Identity:73/227 (32%)
Similarity:124/227 (55%) Gaps:3/227 (1%)


  Fly    82 LVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVV 146
            |.|:..||..|.:::.|:....|....||....:||:...:..:||.....||:.::..:....:
 Worm     4 LFILPAIFGISSLSLWYMICSAPGWPESEGGVFEIPKQFDNFTVLADKFRAYKEDHFGYITTLFI 68

  Fly   147 VAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKT 211
            .||::.||||||||..|:::.|.:|.......|.|..:.||:||||..|.|.||..:.:::.:|.
 Worm    69 CAYLYKQTFAIPGSFLLNVIAGVVYDLWSGFILCCCLTTLGSTLCYMFSELFGREYVFYYFGQKL 133

  Fly   212 SEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQAG 276
            :...:.:::..:.|..::||.||.||.|:|.:|:.:|.:.:||.||.:....|:||.:.|.:|||
 Worm   134 TYLQQKIDDNSNRLLPFLLFARMFPISPSWLLNIVAPFLNIPLPIFVVSALFGLAPYNFICVQAG 198

  Fly   277 KTLQKMTSSSEAFSWTSMGILMACACASLLP 307
            ..|:.:.|..:.||.|:|..|.:.|   |:|
 Worm   199 YILRDLRSWDDVFSTTTMLKLFSFA---LIP 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 41/119 (34%)
bus-19NP_001041162.1 SNARE_assoc 79..199 CDD:286425 42/120 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128091
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.