DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and bus-19

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001041162.1 Gene:bus-19 / 179766 WormBaseID:WBGene00011590 Length:259 Species:Caenorhabditis elegans


Alignment Length:226 Identity:73/226 - (32%)
Similarity:124/226 - (54%) Gaps:3/226 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVV 146
            |.|:..||..|.:::.|:....|....||....:||:...:..:||.....||:.::..:....:
 Worm     4 LFILPAIFGISSLSLWYMICSAPGWPESEGGVFEIPKQFDNFTVLADKFRAYKEDHFGYITTLFI 68

  Fly   147 VAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKT 211
            .||::.||||||||..|:::.|.:|.......|.|..:.||:||||..|.|.||..:.:::.:|.
 Worm    69 CAYLYKQTFAIPGSFLLNVIAGVVYDLWSGFILCCCLTTLGSTLCYMFSELFGREYVFYYFGQKL 133

  Fly   212 SEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQAG 276
            :...:.:::..:.|..::||.||.||.|:|.:|:.:|.:.:||.||.:....|:||.:.|.:|||
 Worm   134 TYLQQKIDDNSNRLLPFLLFARMFPISPSWLLNIVAPFLNIPLPIFVVSALFGLAPYNFICVQAG 198

  Fly   277 KTLQKMTSSSEAFSWTSMGILMACACASLLP 307
            ..|:.:.|..:.||.|:|..|.:.|   |:|
 Worm   199 YILRDLRSWDDVFSTTTMLKLFSFA---LIP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 40/118 (34%)
bus-19NP_001041162.1 SNARE_assoc 79..199 CDD:286425 41/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222755at2759
OrthoFinder 1 1.000 - - FOG0001464
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.