DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and TMEM64

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001008495.2 Gene:TMEM64 HGNCID:25441 Length:380 Species:Homo sapiens

Alignment Length:202 Identity:46/203 (23%)
Similarity:85/203 (42%) Gaps:35/203 (17%)


  Fly    92 SLVTMCYVYAI-FPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTF 155
            |||.:|.:.|: |..|       ..:.|.:....:..:.||....:..|.|.| :||::      
Human   122 SLVLVCVLAALCFASL-------ALVRRYLHHLLLWVESLDSLLGVLLFVVGF-IVVSF------ 172

  Fly   156 AIP---GSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFW-------PKK 210
              |   |.:.|::..|:||.|.:.:.|:    .:|..:...::::|.:||:. .|       .:|
Human   173 --PCGWGYIVLNVAAGYLYGFVLGMGLM----MVGVLIGTFIAHVVCKRLLT-AWVAARIQSSEK 230

  Fly   211 TSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQA 275
            .|...:.||  ..|....:...|:||| |....|....:..:.|..:.:.:..|:.|..::....
Human   231 LSAVIRVVE--GGSGLKVVALARLTPI-PFGLQNAVFSITDLSLPNYLMASSVGLLPTQLLNSYL 292

  Fly   276 GKTLQKM 282
            |.||:.|
Human   293 GTTLRTM 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 27/129 (21%)
TMEM64NP_001008495.2 TVP38 123..294 CDD:223475 42/195 (22%)
VTT domain. {ECO:0000250|UniProtKB:P36164} 186..296 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.