DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43658 and ARHGEF10L

Sequence 1:NP_001259643.1 Gene:CG43658 FlyBaseID:FBgn0263706 Length:2263 Species:Drosophila melanogaster
Sequence 2:NP_060595.3 Gene:ARHGEF10L HGNCID:25540 Length:1279 Species:Homo sapiens

Alignment Length:1110 Identity:333/1111 (30%)
Similarity:510/1111 (46%) Gaps:222/1111 (20%)


  Fly   965 PMLPPAPAGLSQQQLKRRHIVAAIVHSENSYVATLQRLVNDYKKPLEECSPPVLNPVKIATLFHC 1029
            |.|.|.|.|||.||:.||||:.:||.||.|||.:|:|::.||:.||.|..|..|:..|...:|..
Human   301 PELGPMPEGLSPQQVVRRHILGSIVQSEGSYVESLKRILQDYRNPLMEMEPKALSARKCQVVFFR 365

  Fly  1030 LPDILHSHKLFRISLAECVRNWDRDEKIGDCFVSAFGKPQLLEIYSGFINNFSAAMELAKMEEKR 1094
            :.:|||.|.:|:|:|:..|..||..|||||.||::|.|..:|::||.::|||::||.:.|.....
Human   366 VKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFSKSMVLDVYSDYVNNFTSAMSIIKKACLT 430

  Fly  1095 KSALADFFKVKQISAHDRLSFFGLMVKPVQRFPQFILFLQDLLKYTPQGHHDRMSLQLALSQLEL 1159
            |.|..:|.|.:|:.:.||::.:||||||:||||||||.|||:||.||:||.||:||||||::||.
Human   431 KPAFLEFLKRRQVCSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGHPDRLSLQLALTELET 495

  Fly  1160 LAELLNESKREAEQYQAFKEMLGHISGTFNARSLSLSSVSVSDSAGGHRPRYLLREDNVTHMEFN 1224
            |||.|||.||.|:|....:::...:|...:...|..|.           .|.||..:.:|...:.
Human   496 LAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSG-----------QRQLLLCETLTETVYG 549

  Fly  1225 QAGFIVKCKQRRLLLLNDKVICVSVAPKQSHDFGATE---------KLTFKWMFPVNDVEIVDNS 1280
            ..|.::|.|:||:.||||.::|.::..|.::..|..|         |...||...:..|::|:  
Human   550 DRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVE-- 612

  Fly  1281 TSATLSRILTAGLNRGGSLKSNGSSGANGSPY-ANSTLPGHGGGVSGFSGFGDPHSSPAAQLTN- 1343
                                    .|.:|..| .::.|..|.|.         ..:|.:.|..| 
Human   613 ------------------------VGQDGGTYDKDNVLIQHSGA---------KKASASGQAQNK 644

  Fly  1344 ---GADNLCSEMSTLMYDYEVISRIQDLVSSLKGSYKELNANTTRNVLNLIQGSIQRKDEEMAWV 1405
               |...|..|:..|..|..|:.:|..|:|:|.|:|:.||....::....:|..::.|:||:...
Human   645 VYLGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSA 709

  Fly  1406 DSCCLQLI--GR-HKSGKEETF--TFQTQTPAVKKEWITELRLAQLALDPNNSPAWERGGSHPQP 1465
            :.|.|:|:  |: .|||:..:|  .|.|..|..|..|:..|.||::.|...|.|.|         
Human   710 NKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGW--------- 765

  Fly  1466 AHHHPHHHPLQHPHAGAGDPRQTQEQLQLQEAVQQKQSRKMPLFVKAMPVYKSQH---------Q 1521
                                      |...|..:.|.....|:....:|.:.|:.         .
Human   766 --------------------------LCPDEDKKSKAPFWCPILACCIPAFSSRALSLQLGALVH 804

  Fly  1522 TEVRCGCY-YSIANDTKQSGNARRRHKQLNYLWM-CSSDGTSSHITVLA-QHPQQAGNLREAGAF 1583
            :.|.|... :|..:.:...|          |||: ...:|....:.:.: ..|..    |...:|
Human   805 SPVNCPLLGFSAVSTSLPQG----------YLWVGGGQEGAGGQVEIFSLNRPSP----RTVKSF 855

  Fly  1584 DLFETQVSALEFVKGL-DQLKSRDE------PASLLGDLVWLGTDSRKILIYSARNPEQEEQLGS 1641
            .| ...|..:|::..| ::.:||||      |::.:...:.||.....||:||:.: ...:.|.|
Human   856 PL-AAPVLCMEYIPELEEEAESRDESPTVADPSATVHPTICLGLQDGSILLYSSVD-TGTQCLVS 918

  Fly  1642 YSVPGAVQRIL------YHFDAVYVALSGATVLIFRRGNDGV-WQLRDPQ---TIRLGDTDLVVP 1696
            ...|| :|.:|      :|   :...|...|:..:.|.:.|| |.|..|.   |:..|.    |.
Human   919 CRSPG-LQPVLCLRHSPFH---LLAGLQDGTLAAYPRTSGGVLWDLESPPVCLTVGPGP----VR 975

  Fly  1697 SLLPINMCIYASCGNRVYVMNALNGEIQRSFEVQHGATQQVNLMAHSGIGLWISLKNSTMLCLYH 1761
            :||.:...::||||.||.|:.|...:.|:|||........|..|..:|.|:|::..:.|.:.|:|
Human   976 TLLSLEDAVWASCGPRVTVLEATTLQPQQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGTSIRLFH 1040

  Fly  1762 TETFKHLQDINIAS-SVLRHDGKKEQPLNNSSVYVTALMACKGLLWVGTNVGIAVTIPLPRLEGV 1825
            |||.:|||:||||: :.....|:|.       :.||:|:.|:|||||||:.|:.|.:|:|||||:
Human  1041 TETLEHLQEINIATRTTFLLPGQKH-------LCVTSLLICQGLLWVGTDQGVIVLLPVPRLEGI 1098

  Fly  1826 PIISGGINMSCHAHFGPITFLLPLIPKVYPAYKPPTVGAAPLVPSMGDDLQLPAIDAD-PKIQE- 1888
            |.|:|...:|.:.|.||:.||              .|..:.|.|   |.|:....:|: |:.:| 
Human  1099 PKITGKGMVSLNGHCGPVAFL--------------AVATSILAP---DILRSDQEEAEGPRAEED 1146

  Fly  1889 LDDGAVVLRRDLAKEEMSSSNPGADSTASSPRSSKLDKQNSLDQSFTAKIRASL--------ANS 1945
            ..||.       |.|.|..|:.|.:.|    |...:..|..|..  ||.:...|        |:.
Human  1147 KPDGQ-------AHEPMPDSHVGRELT----RKKGILLQYRLRS--TAHLPGPLLSMREPAPADG 1198

  Fly  1946 PAFHRK-------RFRDDPNRMSKTLP-------RGLGAAAAGSGAGG----ASAAGSGTASGNT 1992
            .|....       ...|||:...::.|       :.:.:.|..||..|    .||.||   ||..
Human  1199 AALEHSEEDGSIYEMADDPDIWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSALGS---SGRQ 1260

  Fly  1993 SQHGE 1997
            :..||
Human  1261 APCGE 1265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43658NP_001259643.1 RhoGEF 984..1153 CDD:279015 83/169 (49%)
ARHGEF10LNP_060595.3 RhoGEF 317..501 CDD:238091 94/184 (51%)
WD40 repeat 927..970 CDD:293791 11/46 (24%)
WD40 repeat 978..1007 CDD:293791 12/29 (41%)
WD40 repeat 1016..1046 CDD:293791 11/30 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45108460
eggNOG 1 0.900 E1_KOG3522
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 428 1.000 Inparanoid score I1716
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D43489at33208
OrthoFinder 1 1.000 FOG0001904
OrthoInspector 1 1.000 T608650
orthoMCL 1 0.900 OOG5_132280
Panther 1 1.100 LDO PTHR12877
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5001
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.