DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43658 and Arhgef10

Sequence 1:NP_001259643.1 Gene:CG43658 FlyBaseID:FBgn0263706 Length:2263 Species:Drosophila melanogaster
Sequence 2:XP_002728482.2 Gene:Arhgef10 RGDID:1565043 Length:1373 Species:Rattus norvegicus

Alignment Length:1512 Identity:393/1513 (26%)
Similarity:626/1513 (41%) Gaps:390/1513 (26%)


  Fly   685 GQAAVGVGVGSSSSCGSSS-----------------ERDTKSPCRERDRNL-ERDRDRERDKNDD 731
            |:|:..|.......|.:|:                 |.|.::|..:....: |.|...|....|.
  Rat     4 GEASPPVPAEHEVKCDTSNNEEEGELFDFESGDEVPEADRQAPTADDGTGVAEADGADENTSPDG 68

  Fly   732 LGEEEVLTEEEQTSSSVSSLSAGNQRNSQLRSTFNKAKQHLSFDKWRTAATGSATGSASGPGSS- 795
            .|..|....:|.||...:.:...:..:.                  .|:..|:.||:.|.|.:. 
  Rat    69 TGVAEADGADENTSPDGTRVDEADGADE------------------NTSPAGNGTGAESVPEAEP 115

  Fly   796 --------------------------ATDSNNAASNMIMRRASACTMP----------------- 817
                                      :.|:|.....:.:|..|...:|                 
  Rat   116 EKLVVPIKVNPYSVIDITPFQEDQPPSPDANPEEEGVGLRVPSGYCVPVPCGYAVPSNLPLLLPT 180

  Fly   818 -------------------SSGGGGGAGVGSSQREEATTPGESPGGRLSRWFS------------ 851
                               .:|.|....:.|.....:...|...|..|:||.:            
  Rat   181 YSSQIIIRAQSVEEEVAAEVAGDGQCNSLSSEDLPHSGDQGSQEGSALARWAADPANTAWMENPE 245

  Fly   852 ------IRRGSSHQ------YD---VGGRDGRHS-----TASSFDTPDSGSGNSPKNG------- 889
                  :.|.:|..      ||   .||..|..|     ::|.|::.:..|.:..|||       
  Rat   246 EAIYDDVPRENSDSEPDEMIYDDVENGGEGGNSSLEYGWSSSEFESYEEPSDSEGKNGIPRSFLR 310

  Fly   890 SN----------------------AVAGTGGAGSQGVALDAASPQ--KLANL----------GAS 920
            ||                      .||.|.|      |::|...|  |:..|          |..
  Rat   311 SNHKKQLSHDLTRFKAHCEEKMRGLVASTVG------AMEAQQRQEWKMQRLMKAAKEGTRDGLE 369

  Fly   921 KMMPGVPE-----------SEDD----EATANRF-DVDLMMTPGSRANGTARTAHNRLIVPMLPP 969
            |....|..           |:|.    |...|.| |||              ..|...:   |.|
  Rat   370 KTKAAVKRGRSFIRTKSLVSQDHRYYFEEEQNLFIDVD--------------CKHPEAV---LTP 417

  Fly   970 APAGLSQQQLKRRHIVAAIVHSENSYVATLQRLVNDYKKPLEECSPPVLNPVKIATLFHCLPDIL 1034
            .|.||||||:.||:|:.:||.||.:||..|:|::..|:|||.|..|.:|:..|:..:|:.:.:||
  Rat   418 MPEGLSQQQVVRRYILGSIVESEKNYVDALRRILEQYEKPLSEMEPRLLSDRKLRMVFYRIKEIL 482

  Fly  1035 HSHKLFRISLAECVRNWDRDEKIGDCFVSAFGKPQLLEIYSGFINNFSAAMELAKMEEKRKSALA 1099
            ..|.:|:|:||..|..||..|.|||.||::|.|..:|:.||.::||||.|:.:.|.....|.|..
  Rat   483 QCHSMFQIALASRVSEWDAVETIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFL 547

  Fly  1100 DFFKVKQISAHDRLSFFGLMVKPVQRFPQFILFLQDLLKYTPQGHHDRMSLQLALSQLELLAELL 1164
            :|.|:.|.|:.||::...||::|:||||||||.|||:||.|.:||.||:.||:||::||.|||.|
  Rat   548 EFLKLSQDSSPDRVTLHSLMMRPIQRFPQFILLLQDMLKNTAKGHPDRLPLQMALTELETLAEKL 612

  Fly  1165 NESKREAEQYQAFKEMLGHISGTFNARSLS--LSSVSVSDSAGGHRPRYLLREDNVTHMEFNQAG 1227
            ||.||:|:|....|:    |:...|.|.|:  |||.:          |||:|.|:|....:|..|
  Rat   613 NERKRDADQRCEIKQ----IAKAINERYLNKLLSSGN----------RYLVRSDDVIETVYNDRG 663

  Fly  1228 FIVKCKQRRLLLLNDKVICVSVAPKQSHDFGA--TEKLTFKWMFPVNDVEIVDNSTSATLSRILT 1290
            .|||.||||:.:|||.::|.:.:.:.||:..|  .::...||..|:..|::::.|          
  Rat   664 EIVKTKQRRIFMLNDVLMCATASSRNSHESHAMMNQRYLLKWSVPLGQVDVIEYS---------- 718

  Fly  1291 AGLNRGGSLKSNGSSG-ANGSPYANSTLPGHGGGVSGFSGFGDPHSSPAAQLTNGADNLCSEMST 1354
                        |||| .:.|.:..:..|.....|:...    ||     ::..|...|..::..
  Rat   719 ------------GSSGTGDHSRHHTAHSPESLAVVANVK----PH-----KVYMGPGQLYQDLQN 762

  Fly  1355 LMYDYEVISRIQDLVSSLKGSYKELNANTTRNVLNLIQGSIQRKDEEMAWVDSC--CLQLIGRH- 1416
            |::|..|:.:|..|:.:|:|||:.||.:...:..:.:|..|.||::.:...|.|  .|||.|:. 
  Rat   763 LLHDLNVVGQISQLIGNLRGSYQNLNQSVAHDWTSGLQQLILRKEDAIRAADRCRIQLQLPGKQD 827

  Fly  1417 KSGKEETFT--FQTQTPAVKKEWITELRLAQLALDPNNSPAW---ERGGSHPQPAHHHPHHHPLQ 1476
            |||:...||  |.|.|||:|:.|::.|::|:|||:..|...|   :..||..:     ...|||.
  Rat   828 KSGRPTFFTAVFNTFTPAIKESWVSSLQMAKLALEEENHMGWFCVDDDGSLAK-----KETHPLL 887

  Fly  1477 HPHAGAGDPRQTQEQLQLQEAVQQKQSRKMPLFVKAMPVYKSQHQTEVRCGCY----YSIANDTK 1537
            ..|..                          :.|...|.:|      :.|..|    |. :||.:
  Rat   888 VGHTS--------------------------VMVAKQPEFK------IECAAYNPEPYP-SNDNQ 919

  Fly  1538 QSGNARRRHKQLNYLWMCSSDGTSSHITVLAQHPQQAGNLREAGAFDLFETQVSALEFV-----K 1597
            .:..:..|    .:||:.|.......:.:::   .|:.|.:....|:: |:::..:.::     |
  Rat   920 PASPSTAR----GFLWIGSCSNQMGQVAIVS---FQSANPKVIECFNV-ESRILCMIYIPAEESK 976

  Fly  1598 GLDQLKSRDEPASLLG----DLVWLGTDSRKILIYSARNPEQEEQLGSYSVP--GAVQRILYHFD 1656
            ..:...::|..|:...    ..:.|||:...|.||.:....::.:|..:..|  ..|..:.....
  Rat   977 PQEPADTKDPEATASRAPHVPTICLGTEEGSISIYKSSQGCKKVRLQHFYTPDKSTVMSLACSPH 1041

  Fly  1657 AVYVALSGATVLIFRRGNDGVWQLRDPQTIRLGDTDLVVPSLLPINMCIYASCGNRVYVMNALNG 1721
            .:|..|...:|..:.:..||.|.....|.|:||  .|.|.|||.:...::|:.|.:|::.:....
  Rat  1042 GLYAGLVNGSVASYTKAPDGSWNSEPQQVIKLG--VLPVRSLLLVEGALWAASGGQVFMASVETH 1104

  Fly  1722 EIQRSFEVQHGATQQVNLMAHSGIGLWISLKNSTMLCLYHTETFKHLQDINIASSVLRHDGKKEQ 1786
            .::...|........::.||.:|:|:||:..:.:.|.|:||||.|||||:||           :.
  Rat  1105 TVENQLEAHQDEGMVISHMAVAGVGIWIAFTSGSTLRLFHTETLKHLQDVNI-----------DA 1158

  Fly  1787 PLN-----NSSVYVTALMACKGLLWVGTNVGIAVTIPLPRLEGVPIISGGINMSCHAHFGPITFL 1846
            |::     :..:.||:|:.|.|||.|||::|:.|.:|:|||:|:|.::|...:|.|||.||:.|:
  Rat  1159 PVHSMLPGHQRLSVTSLLVCHGLLMVGTSLGVVVALPVPRLQGIPKVTGRGMVSYHAHNGPVKFI 1223

  Fly  1847 LPLIPKVYPAYKPPTVGAAPLVPSMGDDLQLPAIDADPK-----------IQELDDGAVVLRRD- 1899
            :     ...|::  ....|...|....:||    |.|||           :.:.|....|...| 
  Rat  1224 V-----TATAFQ--NKDRARDRPRSSSELQ----DEDPKDLLCGEEGTSCLGQTDTSTAVWLGDS 1277

  Fly  1900 ---LAKEEMSSSNPGADSTASSPRSSKLDKQNSLDQSFTAKIRASLANSPAFHRKRFRDDPNRMS 1961
               .|:.::|||     |.:.|..||.|: ..|:|.|....:|    :..||.|.|      ..|
  Rat  1278 LGLTAQNDLSSS-----SGSLSHGSSSLE-HRSVDSSLCDLLR----DPSAFPRSR------AQS 1326

  Fly  1962 KTLPRGLGAAAAGSGAG 1978
            ....|...|.....|.|
  Rat  1327 SRRARASSALVVCGGQG 1343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43658NP_001259643.1 RhoGEF 984..1153 CDD:279015 76/169 (45%)
Arhgef10XP_002728482.2 RhoGEF 436..614 CDD:279015 84/178 (47%)
PH-like 646..>712 CDD:302622 25/66 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45103985
eggNOG 1 0.900 E1_KOG3522
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D43489at33208
OrthoFinder 1 1.000 FOG0001904
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12877
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.