DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43658 and Arhgef17

Sequence 1:NP_001259643.1 Gene:CG43658 FlyBaseID:FBgn0263706 Length:2263 Species:Drosophila melanogaster
Sequence 2:NP_001074585.1 Gene:Arhgef17 MGIID:2673002 Length:2057 Species:Mus musculus

Alignment Length:2176 Identity:446/2177 (20%)
Similarity:760/2177 (35%) Gaps:635/2177 (29%)


  Fly    71 QQKLQQQQQQQQQQQLEAVHGGVAKQCLQFPPP-------------PDYPPPITGGGGSPVNTTP 122
            :::.|.|||::.|:..:.:|...:     |..|             ..||...:....|......
Mouse   196 RRRRQHQQQERAQRPADGLHSWHS-----FSQPQAGARASSSSSIASSYPVSRSRAASSSEEEEE 255

  Fly   123 GRRQQL-PRYP----------DPDPDAIEICNESATLETSPYHLKQLAARHSKTLGRNLGHQPHH 176
            |.:.|| |:.|          |.||:..:                     ..:..||.|  :|..
Mouse   256 GPQSQLGPQSPAYLGGHSSGSDEDPNGED---------------------GRRWRGRGL--RPGR 297

  Fly   177 HHTVHLHHDYSYAYYEPGAAMRHSNVPGAVSSGGGGGGGGAGRV-------SSVVDTSSSSSPTA 234
            ...||            |.    |.....::.||.|..||.|..       :|:.:..:.:.|..
Mouse   298 SQLVH------------GC----SQDSDELNPGGLGSAGGVGSPEPPTSPRTSMDEWGTGTQPCL 346

  Fly   235 EPPPNSIRAL---------LSKGKKNKQLVSPATLQSYQTRYHKLTT---------KSGMGQSEN 281
            ..|..|:|.:         ::|......|.|||..:. .:||....|         :|.:|    
Mouse   347 PGPQESLRPMSDTGGAPFRVAKVSFPAYLASPAGSRG-SSRYSSTETLKDDDLWSSRSSVG---- 406

  Fly   282 FYEEINAAALQTSSGHHLRSTVGSHSAGSLN--QTLVEEELRRVQNRHHKILGELNLSVEAMLMP 344
             :....:.:..|..|..||....|.|.|.:.  :.|.:..|...:||..|.|...:::.|.:.:.
Mouse   407 -WGVYRSPSFGTGDGLLLRPQTRSRSKGPVGTARPLRDGGLDLDKNRQRKSLSNPDIASETLTLL 470

  Fly   345 ESPPKSIDQQPLGSGSGGSGG---------AEATPPQPSVSVTAASGQPPT-------ILARLTS 393
            ......:.:..:...|||.|.         :..:|.:.|.|..:.|...||       :.|.|..
Mouse   471 SFLRSDLSELRVRKPSGGPGNRPLDGRDSPSAGSPMEQSESTLSQSPTSPTTRPTLKDLTATLRR 535

  Fly   394 ASADNICDSGGEAGKRTKTAPGCPGGGVEQLLTTTCGDLDSGFSGSSGASYIGSLRLSKTQHIKC 458
            |.:.: |.....|.:..:|:...|... |.||            ..|||.......:.:.|:::.
Mouse   536 AKSFS-CSEKPMARRLLRTSALKPSSS-ELLL------------AGSGAEEDPLPLVVQDQYVQE 586

  Fly   459 ARQT----PTVGTQSCRSFQRAATVYDEAGMSGGGGQS------GSSFLTRASCGRRILSCARIR 513
            |||.    ..:|.|.........|..|.||....|.:|      ..|.||....|          
Mouse   587 ARQVFEKIQRMGAQQDDGNDVCPTSPDWAGDMTQGHRSQEELSGPESNLTDEGIG---------- 641

  Fly   514 AAEDPGP------------------------NHRIA-------GGNGIQTVQTTATESKARSFWS 547
              .||.|                        ||.:.       ||..:.:.:|..|....|    
Mouse   642 --ADPEPLGAAFCSLDPAGVWRPLSSTSAQTNHHLGAGTEDSLGGRALVSPETPPTPGALR---- 700

  Fly   548 RKGWRKLPGFSTSTSSINDTGLSDEHKLNSGSWEDTLDEPHHHHAHHSHH--------------- 597
            |:  ||:|....:.:.:::...|:.::    |..|.:  |..|.|..|..               
Mouse   701 RR--RKVPPSGPNGTELSNGEASEAYR----SLSDPI--PQRHRAATSEEPSGFSVDSNLLGSLN 757

  Fly   598 -----------QQHLHQHHSHLSQRHQQQQQQQQQLQQTSFIGSPPSSASITTAQLHSAFSR--- 648
                       .:.|...||..|...::.:..|:.:|  |.:..|            .|..|   
Mouse   758 SKTGLPVTPAMDEGLTSGHSDWSVVSEENKDYQEVIQ--SIVQGP------------GALGRMGE 808

  Fly   649 -RIAEQ--RERDQRDQRDQREAVGCTAATIAGGSFSANGGQAAVGVGVGSSSSCGSSSERDTKSP 710
             |||.:  :::...|...:.|        :.|..|...||:                       |
Mouse   809 DRIAGKTPKKKSLSDPSRRGE--------LTGPGFEGPGGE-----------------------P 842

  Fly   711 CRERDRNLERDRDRERDKNDDLGEEEVLTEE--EQTSSSVSSLSAGNQRNSQLRSTFNKAKQHLS 773
            .||.:..|...           ..|.:|.|:  |....:.:...|.::|:.......:.|.....
Mouse   843 IREVEPMLPPS-----------SSEPILAEQWTEPEDPAPARGRAQSERSLPAPPASSTAHHDFH 896

  Fly   774 FDKWRTAATG---SATGSASGPGSSATDSNNAASNMIMRRASACTMPSSGGGGGAGVGSSQREEA 835
            .|...|:...   :..||...|..|        |:..:|                      |||.
Mouse   897 LDPKLTSVLSPRLTRRGSKKRPARS--------SHQELR----------------------REEG 931

  Fly   836 TTPGESPGGRLSRWFSIRRGSSHQYDVGGRDGRHSTASSFDT----PDSGSGNSPKNGSNAVAG- 895
               .:...|.|::   .|..|.|.        ||::..:..|    |:......|...:....| 
Mouse   932 ---NQDQTGSLTQ---TRSSSKHV--------RHASVPATFTPIVVPEPAMSVGPPVAAPEPVGF 982

  Fly   896 --TGGAGSQGVALDAASPQKLANLGASKM-MPGVPESEDDEATANRFDVDLMMTPGS-------R 950
              .|....|..:|:..:.:.:..|.:..: .||              .|||...|.|       :
Mouse   983 PVRGHPALQAPSLEDVTKRYMLTLHSGDVPAPG--------------PVDLPCLPPSAPPSTETK 1033

  Fly   951 ANGTARTAHNRLIVPMLPPAPAG--LSQQQL-KRRHIVAAIVHSENSYVATLQRLVNDYKKPLEE 1012
            .:|.||...:.       ||||.  .|:.|: .|:|:...::.:|.|||.:|:.|:..|.:||::
Mouse  1034 PSGAARATPDE-------PAPASKCCSKPQVDMRKHVTMTLLDTEQSYVESLRTLMQGYMQPLKQ 1091

  Fly  1013 ------CSPPVLNPVKIATLFHCLPDILHSHKLFRISLAECVRNWDRDEKIGDCFVSAFGKPQLL 1071
                  |.|.:::.:     |..:|::|..|:.|...:..||:.|...:|:|...|.:|.|..|:
Mouse  1092 PENSLLCDPSLVDEI-----FDQIPELLEHHEQFLEQVRHCVQTWHAQQKVGALLVQSFSKDVLV 1151

  Fly  1072 EIYSGFINNFSAAMELAKMEEKRKSALADFFKVKQISAHDRLSFFGLMVKPVQRFPQFILFLQDL 1136
            .|||.:|:||..|.:..::.::.:.|...|.:.......::.:...||:|||||.|::.|.::||
Mouse  1152 NIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDL 1216

  Fly  1137 LKYTPQGHHDRMSLQLALSQLELLAELLNESKREAEQYQ----AFKEMLGHISGTFNARSLSLSS 1197
            ||:||:.|.|...|..|...::.:||.:|:..|.||:.:    ..:|:..||.|..:.::     
Mouse  1217 LKHTPEDHPDHPLLLDAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEGMEDLQA----- 1276

  Fly  1198 VSVSDSAGGHRP-RYLLREDNVTHMEFNQAGFIVKCKQRRLLLLNDKVICVSVAPKQ-------- 1253
                       | |..||::.|..::     .|...|.|.|.|..|.::|.::..|.        
Mouse  1277 -----------PLRRFLRQEMVIEVK-----AIGGKKDRSLFLFTDLIVCTTLKRKSGSLRRSSM 1325

  Fly  1254 -----SHDFGATEKLTFKWMFPVNDVEIVDNSTSATLSRILTAGLNRGGSLKSNGSSGANGSPYA 1313
                 :.......|....|..|:.|.:|:..::.||....:...::|   |..:           
Mouse  1326 SLYTAASVIDTASKYKMLWKLPLEDTDIIKGASQATNRETIQKAISR---LDED----------- 1376

  Fly  1314 NSTLPGHGGGVSGFS-GFGDPHSSPAAQLTNGADNLCSEMSTLMYDYEVISRIQDLVSSLKGSYK 1377
            .:||    |.:|..| ..|.||.|        .|:...::|..|  :..:|..|.|..||.....
Mouse  1377 LATL----GQMSKLSESLGFPHQS--------LDDALRDLSAAM--HRDLSEKQALCCSLAFPPT 1427

  Fly  1378 ELNANTTRNV---------------LNLIQGSIQRKDEEMAWVDSCC----LQLIGRHKSGKEET 1423
            :|....||..               |...|...:.| .::|...||.    |:.|...|:.....
Mouse  1428 KLELCATRPEGTDSYIFEFPHPDARLGFEQAFDEAK-RKLASSKSCLDPEFLKAIPIMKTRSGMQ 1491

  Fly  1424 F-----TFQTQTPAVKKEWIT-------ELRLAQLALDPNNS----------------PAWERGG 1460
            |     ||.:......:.|:.       ::.|..|..:|:..                |     |
Mouse  1492 FSCAAPTFSSCPEPAPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVP-----G 1551

  Fly  1461 SHPQPAHHHPHHHPLQHPHAGAGDPRQTQE----QLQLQEAVQQKQSRKMP-------------- 1507
            ..|:.....|  .||::|      |..|.|    :|.::...:::.:..:.              
Mouse  1552 LQPRCPREQP--EPLRNP------PETTLESTGPELDVEATAEEEAATTLAEPGPQPCLHISISG 1608

  Fly  1508 --LFVKAMPVYKSQHQTEVRCGCYYSIANDTKQSGNARRRHKQLNYLWMCSSDGT--------SS 1562
              |.::..|. |...|.|:  ..:.|.::|......:.....|.:...:.||.|.        ::
Mouse  1609 SGLEMEPGPA-KGDPQPEL--VPFDSDSDDESSPSPSGTLQSQASQSTISSSFGNEETPSSKEAT 1670

  Fly  1563 HITVLAQHPQQAGNLREAGAF------------DLFETQVSALEFVKG-LDQLKSRDEPASLLGD 1614
            ..|..::..|:.|.|..:|:|            .....:.|...|.:| |:.|.|.|..|  ...
Mouse  1671 AETTSSEEEQEPGFLSLSGSFGPGGPCGTSPMDGRALRRSSRGSFTRGSLEDLLSVDPEA--YQS 1733

  Fly  1615 LVWLGTDSRKILIYSA-------RNPEQEEQLGSYSVPGAVQRILYHFDAVYVALSGATVLIFRR 1672
            .|||||:...:.:|.:       ||..:.:...|      |..|||..:.|:|:|:...:::::|
Mouse  1734 SVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAAS------VTCILYLNNKVFVSLANGELVVYQR 1792

  Fly  1673 GNDGVWQLRDPQTIR---LGDTDLVVPSLLPINMCIYASCGNRVYVMNALNGEIQRSFEVQHGAT 1734
            .....|   |||..:   ||.....:..::.:...::..|.|||.|::....:::.:|.|...::
Mouse  1793 EAGRFW---DPQNFKSMTLGSQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQDSS 1854

  Fly  1735 QQVNLMAHSGIGLWISLKNSTMLCLYHTETFKHLQDINIASSVLRHDGKKEQPLNN---SSVYVT 1796
            :.|..|..|.:|:|::||.|..:||||.:||:.|.::::...|.|.....:..:..   :.:.:|
Mouse  1855 RSVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRIT 1919

  Fly  1797 ALMACKGLLWVGTNVGIAVTIP-------LPRLEGVPIISGGINMSCHAHFGPITFL----LP-- 1848
            ||:.|..||||||:.|:.:|||       .||   .|:...|:   |..|.|.:.||    ||  
Mouse  1920 ALLVCAELLWVGTSAGVVLTIPTSPSTVSCPR---APLSPAGL---CQGHTGHVRFLAAVQLPEG 1978

  Fly  1849 --LIPKVYPAYKPPTVGAAPLVPSMGDDLQLPAID------------ADPKIQELDDGAVVLRRD 1899
              |:....|   ||        |..|.: :||::|            |.||:..:..|.      
Mouse  1979 FNLLCSTPP---PP--------PDTGPE-KLPSLDHRDSPRRRGPTSARPKMLVISGGD------ 2025

  Fly  1900 LAKEEMSSSNPGADSTASSPRSSKLDKQNSL 1930
             ..|:...|:.|..|:.:..|.   |..|.|
Mouse  2026 -GSEDFRLSSGGGGSSETVGRD---DSTNHL 2052

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43658NP_001259643.1 RhoGEF 984..1153 CDD:279015 52/175 (30%)
Arhgef17NP_001074585.1 RhoGEF 1067..1246 CDD:279015 56/184 (30%)
PH-like 1279..>1425 CDD:302622 38/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3522
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5001
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.