DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43658 and osg-1

Sequence 1:NP_001259643.1 Gene:CG43658 FlyBaseID:FBgn0263706 Length:2263 Species:Drosophila melanogaster
Sequence 2:NP_498172.3 Gene:osg-1 WormBaseID:WBGene00019832 Length:1182 Species:Caenorhabditis elegans

Alignment Length:1380 Identity:283/1381 (20%)
Similarity:497/1381 (36%) Gaps:355/1381 (26%)


  Fly   676 AGGSFSANGGQAAVGVGVGSSSSCGSSSERDTKSPCRER-DRNL----ERDRDRERDKNDDLGEE 735
            |..|.|:......|.|.....|:..|.|.|::....|.| |.||    ||:|.|||.::......
 Worm     7 ADDSDSSTDSSPPVAVPRPKRSATVSPSTRNSFYNSRRRSDANLNFFNERERQRERRRSMVRASR 71

  Fly   736 EVLTEEEQTSSSVSSLSAGNQRNSQLRSTFNKAKQH--LSFDKWRTAATGSAT---GSASGPGSS 795
            |  ..|.:.:|..:.....::.|..:.|...:|.|.  ||..|:.:|:.....   .|.|| |..
 Worm    72 E--RSESRRASQQNLRKTNSEPNVDMPSIDVEALQKLLLSIPKFVSASRNRINQRHDSDSG-GEM 133

  Fly   796 ATD----SNNAASNMIMRRASAC-TMPSSGGGGGAGVGS-----------SQREEATTPGESPGG 844
            .|:    .:.|.|...::|..|. :..||..||...:..           |..:|::...::..|
 Worm   134 TTEIEELKDAAKSIQSLQRVLAYPSQTSSDRGGNRRLADPVESCLESSVFSDVDESSLATDTIEG 198

  Fly   845 RLSRWFSIRRG------------SSHQYDVGGRDGRHSTASSFDTPD----SGSGNSP----KNG 889
            |.| ..|.|.|            .:.|:.......|:|.:.....||    |...:.|    :|.
 Worm   199 RRS-GISTRLGHPRGVMQFIPSIRNDQFVPTSEIRRNSISRKSSVPDGFMTSEMESEPVPNVRNR 262

  Fly   890 SNAVAGTGGAGSQGVALDAASPQKLAN-------LGASKMMPGVPESEDDEATANRFDVDLMMTP 947
            ...:.....:.|..:.:|..| :.||.       |...:..|..|| :....:.|.:    :.:.
 Worm   263 RRGIVDEMFSSSTSLLVDRPS-ETLAGVNRFAKLLDTFRSRPTSPE-QHPSISWNPY----VYSD 321

  Fly   948 GSRA---NGTARTAHNRLIVPMLPPAPAGLSQQQLKRRHIVA-AIVHSENSYVATLQRLVNDYKK 1008
            |..|   .|...:.|...|:.....:.|.| ::....||:.| .::.:|.|:|..|:.||..|.:
 Worm   322 GGEALETCGMEDSLHEADILLWKKRSRASL-RRHYSVRHLAARELLDTEKSFVEGLEFLVTKYMR 385

  Fly  1009 PLE---ECSPPVLNPVKIATLFHCLPDILHSHKLFRISLAECVRNWDRDEKIGDCFVSAFGKPQL 1070
            ||.   ||:  ::....:..:|:.:|:||..|::...:|::.:..|.:|..:||..::.|.|..:
 Worm   386 PLRQPLECT--LIEASLVDKIFYRIPEILAHHQVLLTTLSQRIDQWHKDAILGDVLLAHFSKQSM 448

  Fly  1071 LEIYSGFINNFSAAMELAKMEEKRKSALADFFKVKQISAHDRLSFFGLMVKPVQRFPQFILFLQD 1135
            :|.|..|::||..| :.:.::.::|.|...::........::|....|::.|:||.|::.|.::.
 Worm   449 IETYISFVDNFKFA-KASIIQARQKHAFEKYYNRCCRDHPNKLDLDSLLISPIQRVPRYELIVKQ 512

  Fly  1136 LLKYTPQGHHDRMSLQLALSQLELLAELLNESKREAEQY-QAFKEMLGHISGTFNARSLSLSSVS 1199
            :||:||..|.||..|..|...:..||..:|:.|..:||. |..:|:...:.|        |..:.
 Worm   513 MLKHTPVEHEDRERLLRAQRHIHCLAVAINQHKDGSEQMEQRLREIEAIVDG--------LDDLV 569

  Fly  1200 VSDSAGGHRPRYLLREDNVTHMEFNQAGFIVKCKQRRLLLLNDKVICVSVAPK--------QSHD 1256
            ..|       |.|||.|.:|....:        ::|.:.:|:|.::..||..|        .|..
 Worm   570 TKD-------RTLLRHDIITLKGTD--------RERCIFMLSDLLLVTSVKKKPKVLYSKMSSQS 619

  Fly  1257 FGATEKLTFKWMFPV--NDVEIVDNSTSATLSRILTAGLNRGGSLKSNGSSGANGSPYANSTLPG 1319
            .|..|...||.:|.|  .||:|    :..|||::                               
 Worm   620 MGFLEGNRFKLLFKVALEDVQI----SKDTLSQL------------------------------- 649

  Fly  1320 HGGGVSGFSGFGDPHSSPAAQLTNGADNLCSEMSTLMYDYEVISRIQDLVSSLKGSYK----ELN 1380
                                      :.:..::.:...|..|:.::..|.|.||...|    .|.
 Worm   650 --------------------------EEVERKLESSREDDRVLKKMSQLCSLLKCERKVLMEMLE 688

  Fly  1381 ANTTRNVLNLIQGSIQRKDEEMAWVDSCCLQLIGRHKSGKEETFTFQTQTPAVKKEWITELRLAQ 1445
            ...|.|.:     ||:..:|:|:                                   ::..|:.
 Worm   689 TMETSNSM-----SIRELNEQMS-----------------------------------SDPDLSA 713

  Fly  1446 LALDPNNSPAWERGGSHPQPAHHHPHHHP--LQHPHAGAGDPRQTQEQLQLQEAVQQKQSRKMPL 1508
            :.||...|..:|                |  |:.|:|         |:..:.||:.:.....:..
 Worm   714 VHLDVLTSNGFE----------------PFVLEFPNA---------EKRSVFEAMFKDAKATLAK 753

  Fly  1509 FVKAMPVYKSQHQTEVRCGCYYSIANDTK---QSGNAR----RRHKQLNYLWMCSSDGTSSHITV 1566
            .:.|.|          .|.....||:.|:   |...|.    :|......||:|:||..|..:.|
 Worm   754 NLLAAP----------SCSLKTIIAHQTRPGLQLCTATVVPGKRVDSTPSLWVCASDKFSGQVAV 808

  Fly  1567 LAQHPQQAGNLREAGAFDLFETQVSALEFV------------------------------KGLDQ 1601
            :|   ...|.:.......:....|:|:..|                              .|.|.
 Worm   809 MA---LDTGEITIESCSAIGNAAVTAMCTVPPPMKLRKRKIKSQKSLEHLLNETIMDINSSGSDT 870

  Fly  1602 LKSRDEPASLLGD-LVWLGTDSRKILIYSARNPEQEEQLGSYS------VPGAVQRILYHFDAVY 1659
            ..|.||..|..|. .||:|.|..::.:.::     .|::.|.:      :..::..|......|.
 Worm   871 ESSSDEGTSTAGQTTVWIGNDDGEVFVVNS-----TERVRSRARDRLARLRNSITSICAANGNVL 930

  Fly  1660 VALSGAT---VLIFRRGNDGVWQLRDPQTIRLGDT-DLVVPSLLPINMCIYASCGNRVYVMNALN 1720
            ||.|.:.   :|:||..:||.|.|.:|||:  |.. ...:.|:..|...:..:.||.::......
 Worm   931 VATSYSNQVQLLLFRPASDGSWDLENPQTV--GHVCQAPITSMQLIGRRVIIASGNWLHAYFVDT 993

  Fly  1721 GEIQRSFEVQHGATQQVNLMAHSGIGLWISLKNSTMLCLYHTETFKHLQDINIASSVLRHDGKKE 1785
            |:.|...|:. .::..:.||..:|..:::..:.||.:.:........:...|:.|.|......:|
 Worm   994 GKFQPPVEIL-PSSDVITLMYVTGQNVFLCGRKSTEVFVVDVFNLSIINHFNVVSFVRSQLSGRE 1057

  Fly  1786 QPLNN---SSVYVTALMACKGLLWVGTNVGIAVTI--------PLPRLEGVPIISGGINMSCHAH 1839
            ..|..   ..:.::.|...:..||:||:.|..::.        |.|.|....|          .|
 Worm  1058 HILREHKMGCLRISCLTVARSHLWIGTSAGCVLSTSVQSARSQPTPDLRVCEI----------GH 1112

  Fly  1840 FGPITFLLPLIPKVYPAYKPPTVGAAPLVPSMGDDLQLPAIDADPKI-----QELDDGAVVLRRD 1899
            .||...|||:        ..|:....|........|.:||..:...:     :.||||.      
 Worm  1113 SGPCRILLPV--------HTPSHSNHPSRKQKRSSLNVPAQQSSQLMLVSCGEGLDDGT------ 1163

  Fly  1900 LAKEEMSSSNPGADS 1914
                  ::.:|..|:
 Worm  1164 ------ATQDPSTDA 1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43658NP_001259643.1 RhoGEF 984..1153 CDD:279015 47/173 (27%)
osg-1NP_498172.3 RhoGEF 361..543 CDD:214619 51/185 (28%)
PH-like 524..>612 CDD:302622 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3522
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I2801
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D43489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5001
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.