DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5613 and ENGase85B

DIOPT Version :8

Sequence 1:NP_573215.1 Gene:CG5613 / 32726 FlyBaseID:FBgn0030839 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_187715.2 Gene:ENGase85B / 820275 AraportID:AT3G11040 Length:738 Species:Arabidopsis thaliana

Alignment Length:639 Identity:183/640 (29%)
Similarity:273/640 (43%) Gaps:143/640 (22%)


  Fly    78 SQLEAEPIKD--NRQL-LEFRVRS-RNIDWREYVLPLDTSVRTTPVYLDRQADFVGSTRRQVTED 138
            :|.||.|:.|  ...| :.|.::: :::..|.|..........:.|...|.:|.:         .
plant    47 AQSEAVPLLDLVKPSLPISFPIKALQDLKSRSYFDSFHFQFNRSTVPFRRNSDCL---------P 102

  Fly   139 NRRELLVCHDMMGNYLEDRHFHSSQKYDDYRFVHWSAVDYFCYFSHDYVTIPPCGWLNAAHRHGV 203
            ||..:||||||.|.|::|:.....:....:...||..:|.|.||||..|||||..|.|.||||||
plant   103 NRPRVLVCHDMKGGYVDDKWVQGCENEAGFAIWHWYLMDIFVYFSHSLVTIPPPCWTNTAHRHGV 167

  Fly   204 PVVGTFIV---EATARLDEFLASEESVESTVEALTRLCEHFGFEGWLVNVEVTVPLAKMPRLYRF 265
            .|:||||.   |..|...|.||::||.:...|.|..|....||:|||:|:|..:...::|.:..|
plant   168 KVLGTFITEWDEGKATCKEMLATKESAQMYAERLAELATALGFDGWLINIENDIDEEQIPNMKEF 232

  Fly   266 VRQLTAATESRVPHGRVFWYDSVTDDGQLRWQNELNSRNAKFFRHSHGTLINYAWDEGHLERSAQ 330
            |..|........|...|.||||||..|.|:||::|...|..||....|..:||.|.|.:...|| 
plant   233 VSHLKKVLHLSTPGALVIWYDSVTVRGNLQWQDQLTELNKPFFDLCDGIFMNYTWKESYPNLSA- 296

  Fly   331 QVRREQSPRHRVFMGLDVFGRSRKGGFHSW---ETMELIAKNGFSAGIFAPGWTFETLNRFGYNI 392
            :|..::  :..|:||:|||||...|| ..|   ..::|:.:|..||.||||||.:||.....:: 
plant   297 EVAGDR--KFDVYMGIDVFGRGSFGG-GQWTVNAALDLLKRNNVSAAIFAPGWVYETAQPPNFH- 357

  Fly   393 KNPRGDDQVNASFLARNEAWWSRI---WPTLATHPYTSLPFFTDFCVGSGRAKFERGWRILGEDS 454
                         .|:|: |||.:   |..:.|:|.. |||::||..|.|......|.::  .||
plant   358 -------------TAQNK-WWSLVEKSWGIVQTYPQV-LPFYSDFNQGFGYHVSLEGRQL--SDS 405

  Fly   455 PFFNLSRQSLQPSVPL---------------GRNAM----------HHFDEA----YSGGCSLLV 490
            |::|:|.|||||.:..               |:|..          :.:|.|    ::||.:::.
plant   406 PWYNISCQSLQPLLEFNEDNKDIIQVTVDQEGKNVFDFSEQHLNNYYEYDSAREASFNGGGNIVF 470

  Fly   491 TNYER-----AFRLFVTDFELDRGVLLLRYVFKID------------GDAVGTMFDLLVRVTPLR 538
            ....:     ..|||....:|....:.:.|..|.|            ..::.|...|:....|:|
plant   471 RGKLKGDAYFTTRLFKPHLQLSSSPITISYSVKSDETSNLGILLSFSSPSLETKSILVAPEDPIR 535

  Fly   539 RNDQDLHLFCGDYEGSIVAPQRCYLSPHESDLPSGLFRLHHDSSSLAAGWQMRDYLVKFDGPVRV 603
            |.| |:.|.|              |:               .|....:.|.:.:..:..||.. :
plant   536 RFD-DMSLQC--------------LT---------------TSVQTVSEWTVHEASLVMDGHT-L 569

  Fly   604 QDIGVKYQRPSESSTDAK----LGFVYVDGLTLEDLKDTWTDIPVYSKHMWNEQ 653
            .:|.....||..|:..|:    ||.:.|        ||          |:.|:|
plant   570 TEISAFCYRPENSTKSAEFVALLGHISV--------KD----------HVQNQQ 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5613NP_573215.1 GH85_ENGase 144..476 CDD:119364 131/366 (36%)
ENGase85BNP_187715.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I1076
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D722800at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130163
Panther 1 1.100 O PTHR13246
Phylome 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.