DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5613 and Engase

DIOPT Version :8

Sequence 1:NP_573215.1 Gene:CG5613 / 32726 FlyBaseID:FBgn0030839 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_006247865.1 Gene:Engase / 303702 RGDID:1310868 Length:733 Species:Rattus norvegicus

Alignment Length:690 Identity:214/691 (31%)
Similarity:304/691 (44%) Gaps:154/691 (22%)


  Fly    30 GITTEEEEEVVPVKKKRTEEGGGELKEVACEKETVQRE-----------KCQDKNTCRCSQLEAE 83
            |.|..|::.....:::|..:|....|:.  |:|.|.|:           :..||:|.|       
  Rat    16 GSTAPEKQAQDQPERRRRRQGRRINKDQ--EEEAVFRDVVNFAPDPLPARYYDKDTTR------- 71

  Fly    84 PIKDNRQLLEFRVRSRNIDWREYVLPLDTSVRTTPVYLDRQADFVG--------STRRQVTEDNR 140
            ||.                  .|:..|:..:..||:..|      |        ..|:......|
  Rat    72 PIS------------------FYLSTLEELLAWTPLMED------GFNVALEPLECRQPPLSSPR 112

  Fly   141 RELLVCHDMMGNYLEDRHFHSSQKYDDYRFVHWSAVDYFCYFSHDYVTIPPCGWLNAAHRHGVPV 205
            ...|:||||||.|||||....|:..:.|.|.||..:|.|.||||..|||||..|.||||||||.|
  Rat   113 PRTLLCHDMMGGYLEDRFIQGSEVQNPYSFYHWQYIDIFVYFSHHTVTIPPVCWTNAAHRHGVCV 177

  Fly   206 VGTFIVE--ATARLDE-FLASEE-SVESTVEALTRLCEHFGFEGWLVNVEVTVPLAKMPRLYRFV 266
            :||||.|  ...:|.| |||.:| |.::..:.|.::.:.|.|:|||:|:|.::..|.:.....|:
  Rat   178 LGTFITEWQEGGKLCEAFLAGDERSFQAVADRLVQIAQFFRFDGWLINIENSLSPAAVRNTPLFL 242

  Fly   267 RQLTAATESRVPHGRVFWYDSVTDDGQLRWQNELNSRNAKFFRHSHGTLINYAWDEGHLERSAQQ 331
            :.||.....:||.|.|.|||||...|||:||:|||.:|..||....|...||.|.|.||:|...|
  Rat   243 QYLTRQLHQQVPGGLVLWYDSVVQSGQLKWQDELNEQNRVFFDSCDGFFTNYNWREDHLKRMVAQ 307

  Fly   332 VRREQSPRHRVFMGLDVFGRSR--KGGFHSWETMELIAKNGFSAGIFAPGWTFETLNRFGYNIKN 394
            .....:.   |::|:|||.||.  .|.|.:.:::|||.|:||||.:|||||.:|.|.      ||
  Rat   308 AGERLAD---VYVGIDVFARSNVVGGRFDTDKSLELIRKHGFSAALFAPGWVYECLE------KN 363

  Fly   395 PRGDDQVNASFLARNEAWWSRIWPTLATHPYTSLPFFTDFCVGSGRAKFERGWRILGED---SPF 456
                     .|....:.:|..:...|.||...||||.|.||:|.|..:.     ..|::   .|:
  Rat   364 ---------DFFQNQDKFWRLLERFLPTHSICSLPFVTSFCLGLGTRRV-----CYGKEQAVGPW 414

  Fly   457 FNLSRQSLQPSVPLGRNAMHHFD-----------EAYSGGCSLLVTNY------ERAFRLFVTDF 504
            ::.|.|..||.  .|.:.:...:           :|:.||.|||:...      ..|.|||....
  Rat   415 YHPSAQETQPL--FGEHKLAGGNRGWVKTHCCLVDAWHGGSSLLLRGLIPPEVDSVAVRLFSMHV 477

  Fly   505 ELDRGVLLLRYVFKIDGDAVGTMFDLLVRVTPLRRNDQDLHLFCGD----YEGSIV---APQRCY 562
            .:...| .|..|:|.:|..     |:.|.          |.|..||    :.|.::   |.....
  Rat   478 PVPPKV-FLSMVYKFEGST-----DVQVA----------LELTTGDASSCHVGGVLVLNAETGTR 526

  Fly   563 LSPHESDLPSGLFRLHHDSSS----LAAGWQMRDYLVKFDGPVRVQDIGVKYQRP----SESSTD 619
            .||....:|.  .||...:||    |:.||..|.|.|...|.: :||:.|.:.||    .|.|..
  Rat   527 YSPRPLRVPP--TRLARWASSCGQQLSGGWIQRCYEVNLRGCL-LQDLLVSFSRPPGSREEESFI 588

  Fly   620 AKLGFVY-------------VDGLTLEDLKDTWTDIPVYS 646
            .:||.:.             |..:|:..|:  |  :|:.|
  Rat   589 CRLGEIQVVDANSLLAPLPRVQNVTISQLR--W--LPLIS 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5613NP_573215.1 GH85_ENGase 144..476 CDD:119364 138/341 (40%)
EngaseXP_006247865.1 GH85_ENGase 116..426 CDD:119364 137/335 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C301931504
eggNOG 1 0.900 E1_COG4724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 246 1.000 Inparanoid score I3142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D479155at33208
OrthoFinder 1 1.000 FOG0006316
OrthoInspector 1 1.000 T1088727
orthoMCL 1 0.900 OOG5_130163
Panther 1 1.100 LDO PTHR13246
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
98.850

Return to query results.
Submit another query.