DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5613 and engase

DIOPT Version :8

Sequence 1:NP_573215.1 Gene:CG5613 / 32726 FlyBaseID:FBgn0030839 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_002932564.2 Gene:engase / 100496567 XenbaseID:XB-GENE-981873 Length:720 Species:Xenopus tropicalis

Alignment Length:731 Identity:197/732 (27%)
Similarity:303/732 (41%) Gaps:185/732 (25%)


  Fly     4 LESKELASISKVMEN--NDKASENDKITGITTEEEEEVVPVKKKRTEEGGGELKEVACEKETVQR 66
            ::.|.|....|.:..  |.|....:|:      :|:|.      |..|...:|..:...||.::.
 Frog     1 MKRKRLVDEEKALSGSYNKKQRPPEKL------DEDEC------RDAESSAQLANMKVYKEVIRD 53

  Fly    67 E------KCQDKNTCRCSQLEAEPIKDNRQLLE--FRVRSRNID-WREYVLPLDTSVRTTPVYLD 122
            :      :..||||       :|||......||  |..:..|.| :...|:|:  :.|..|:   
 Frog    54 DIVPLSARHHDKNT-------SEPISFFLSNLEELFSWKPTNQDAFNVAVVPI--AKRHPPI--- 106

  Fly   123 RQADFVGSTRRQVTEDNRRELLVCHDMMGNYLEDRHFHSSQKYDDYRFVHWSAVDYFCYFSHDYV 187
                          |..|.:.||||||||.|.:||....|.....|.|.||..:|.|.||||...
 Frog   107 --------------ESQRPKTLVCHDMMGGYQDDRFIQGSGAQQPYIFYHWQHIDIFVYFSHRMF 157

  Fly   188 TIPPCGWLNAAHRHGVPVVGTFIVE---ATARLDEFLASEESV-ESTVEALTRLCEHFGFEGWLV 248
            ::||..|.||||::||.|:||||.|   .....:.|||.|||. .:..:.:.||.|::.|:||.:
 Frog   158 SLPPVCWTNAAHKNGVCVLGTFITEWEDGAKTCESFLAGEESTYHAVADQMVRLAEYYKFDGWFI 222

  Fly   249 NVEVTVPLAKMPRLYRFVRQLTAATESRVPHGRVFWYDSVTDDGQLRWQNELNSRNAKFFRHSHG 313
            |:|..:....:..|..|:..|......|:|.|.|.|||||..:|:|:||||||.:|..||....|
 Frog   223 NIENVLSPVAVSNLPLFLSYLKEQLHERIPGGMVLWYDSVIHEGELKWQNELNDKNRNFFDSCDG 287

  Fly   314 TLINYAWDEGHLERSAQQVRREQSPRHRVFMGLDVFGRSR--KGGFHSWETMELIAKNGFSAGIF 376
            ...||.|.|.||:|..:..||..     :::|:|:|.|..  .|.|.:.:::::|.:.|.||.:|
 Frog   288 IFTNYNWMEDHLQRMEEDPRRTD-----IYVGVDIFARGEVVGGKFDTVKSLQMIRQYGLSAALF 347

  Fly   377 APGWTFETLNRFGYNIKNPRGDDQVNASFLARNEAWWSRIWPTLATHPYTSLPFFTDFCVGSGRA 441
            ||||.:|.|.:               ..||...:.:||.:...|..|...:||..:.||:|.|:.
 Frog   348 APGWVYECLEK---------------EQFLQNQDKFWSLLDSQLLIHSLCTLPICSSFCLGYGKK 397

  Fly   442 KFERGWRILGEDS-PFFNLSRQSLQP--------SVPLGR-NAMHHFDEAYSGGCSLLVTNYERA 496
            ::..|   .|||| |:||||.|.:||        :...|| .::...::|:.||.||::      
 Frog   398 RYSFG---EGEDSGPWFNLSAQEVQPIFSEIQPKAGEDGRVKSLICQEDAWHGGGSLVI------ 453

  Fly   497 FRLFVTDFELDRGV-----------------LLLRYVFKIDGDA-VGTMFDLLVRVTPLRRNDQD 543
                  :..|..|:                 |||..|:|::..: |....:|         :.||
 Frog   454 ------EASLPSGIEGVTIRLFSLHVPAPPKLLLALVYKMENSSNVAVSLEL---------STQD 503

  Fly   544 LHLFCGDYEGSIVAPQRCYLSPHESDLPSGLFRLHHDSSSLAA--------------GWQMRDYL 594
                          .:.|.::..:|..|..:....|....||.              ||:.|.|:
 Frog   504 --------------AKSCNVNKVDSITPLSVESTVHPLQPLAKPPLPVTDTQLNPKHGWEQRYYV 554

  Fly   595 VKFD---------------------------GPVRVQDIGVKYQRPSESSTDAKLGFVYVDGLTL 632
            |...                           |.:|:.|.......|:: .||..|.  :|..|..
 Frog   555 VHLSDCYLNSLSMRFSQLTPKEQEETFTCRIGEIRILDFSHPPLLPAQ-PTDLSLS--HVRWLHN 616

  Fly   633 EDLKDTWTDIPVYSKH 648
            |:....:..:.::..|
 Frog   617 EEANQLFVSLTLHWSH 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5613NP_573215.1 GH85_ENGase 144..476 CDD:119364 128/348 (37%)
engaseXP_002932564.2 GH85_ENGase 114..427 CDD:119364 126/336 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C301931148
eggNOG 1 0.900 E1_COG4724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D479155at33208
OrthoFinder 1 1.000 FOG0006316
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.