DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and CG6431

DIOPT Version :8

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster

Alignment Length:358 Identity:97/359 (27%)
Similarity:137/359 (38%) Gaps:91/359 (25%)


  Fly    75 SLNVICSQALASNKI--KSKY------------SPDINKMN--FQLQTACEKK---------NFP 114
            ||..:....|:.|.|  .|||            :.|:|.:|  ..|...|.|:         |.|
  Fly     7 SLIALLLSLLSLNPITNASKYHREALQFLLRNGNFDLNPLNCHILLWETCPKRFIDYQLFTSNGP 71

  Fly   115 LTSPESMWKSPL------FDVKKKVVILATGWTTTVNGSDT---IEVFSKAYNCRGDVNFVAVD- 169
            ........|:|:      |...::.|.:..|:    ||:..   ::....||..| |.|.:.|| 
  Fly    72 RRGTPLNVKNPITLYKGGFSKHRETVFIIHGF----NGTAIDIHLQFLRDAYLSR-DFNVITVDW 131

  Fly   170 --AARFVDTLYTWSAFNTEEIGENIA--------LGLVKLLDLVPVENIHLIGHSLGAHIVGSAG 224
              ..|:  ..|..|..||....:..|        .|.|:       |.|..:||||||||.|...
  Fly   132 RPLTRY--PCYLHSLINTRLTAQCTAQIYAFLTHYGAVR-------ERITCVGHSLGAHICGMIS 187

  Fly   225 RHLQHLTNQTIPRITGLDPAKPCFNEGEALS-GLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYP 288
               .|||.:.. ||.|||||:|.....::.. .|...||:.:.|:|:|.|.||:.|..|.:::..
  Fly   188 ---NHLTRKQY-RIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCV 248

  Fly   289 GG--MSPLAAG--CFSVTCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRCPGDEVPMGY 349
            .|  :.|...|  .....|:|..|..|.|...|..|:  ||...|                |.|.
  Fly   249 NGGRIQPFCKGNPIRKSRCSHFLSICYLATATFKHNK--FMGVPC----------------PNGC 295

  Fly   350 AVPQNIKGNYFLEVSASA-PFGMHASVVRSAHL 381
            .   |:.|:..|.||... ||.. ||::|..|:
  Fly   296 L---NLSGSKRLPVSGKVNPFEF-ASLIREYHI 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 84/312 (27%)
Pancreat_lipase_like 99..365 CDD:238363 81/302 (27%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.