DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and AT5G64400

DIOPT Version :10

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001032137.1 Gene:AT5G64400 / 836561 AraportID:AT5G64400 Length:162 Species:Arabidopsis thaliana


Alignment Length:104 Identity:35/104 - (33%)
Similarity:43/104 - (41%) Gaps:33/104 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPSMFQQMAAT-AGGVA--VGSAIGH 85
            ||.|.||..::.||.|...||.|||..|.....|        ||..:.:| |.|:|  .|||:.|
plant    11 APRPRPAAARSPAPQPVHRAPPPAPAQASGGGGG--------MFSGIGSTIAQGMAFGTGSAVAH 67

  Fly    86 ----------TVGHGLTSLFSGSGDKEAAAPAPAAAAPA 114
                      |:.|            ||...|.|:||||
plant    68 RAVDSVMGPRTIQH------------EAVEAASASAAPA 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:429096
AT5G64400NP_001032137.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.