DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and Dnm3

DIOPT Version :10

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_612547.1 Gene:Dnm3 / 171574 RGDID:727949 Length:869 Species:Rattus norvegicus


Alignment Length:125 Identity:34/125 - (27%)
Similarity:41/125 - (32%) Gaps:39/125 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPSMFQQM 70
            ||..|.|:|:|...:.    ||.|.|..:|.||||  .|.|.|.|..|.....|.|..|      
  Rat   768 RSPPPSPTTQRRLTLS----APLPRPASSRGPAPA--IPSPGPHSGAPPVPFRPGPLPP------ 820

  Fly    71 AATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAP-APAAAAPAPQQPYYAQQQQPNEP 129
                                    |..|.|...|.| .|:....||  |....::.|..|
  Rat   821 ------------------------FPNSSDSYGAPPQVPSRPTRAP--PSVPSRRPPPSP 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:429096
Dnm3NP_612547.1 DYNc 6..245 CDD:197491
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 38..45
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 64..66
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 136..139
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 205..208
Dynamin_M 215..502 CDD:460033
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 235..238
PH_dynamin 526..635 CDD:269958
GED 655..745 CDD:460495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 752..869 34/125 (27%)
MISS <753..841 CDD:318115 29/108 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.