DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nprl2 and NPR2

DIOPT Version :8

Sequence 1:NP_573174.1 Gene:Nprl2 / 32677 FlyBaseID:FBgn0030800 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_010852.4 Gene:NPR2 / 856647 SGDID:S000000788 Length:615 Species:Saccharomyces cerevisiae

Alignment Length:501 Identity:116/502 (23%)
Similarity:184/502 (37%) Gaps:158/502 (31%)


  Fly    40 IRCIFLSEFHATAGCKISCQVPDNYISKD--VFDAINVYIIPKQHLQRCILTVNAMDVKIVGYPV 102
            |..||.|.||.|.|.||..:.|.|.:...  .|:....|||||..|...::|......:||.|||
Yeast    11 IHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLITFKYGTYRIVCYPV 75

  Fly   103 GIQDQQKYARNAFLFNLCFVCDSRARSVQYEPVVKKLSEYLIMMEEESCFLSRED---------- 157
            .| :...||||.|.||..||......:..|||.:.:|.:...::||::..||:.:          
Yeast    76 TI-NSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQLLSKSERDPVFFDLKV 139

  Fly   158 -----------------------------------DKR------------------RLQNIFETV 169
                                               |.|                  .:|::...:
Yeast   140 LENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSRYSDLIKDLGLPQSAFSIQDLLMRI 204

  Fly   170 LRDLNERKVATI-VEGDNTIYLKIV-MHKPDPPPVKDHMVPLLLANLRDAPLDNWDLTTQQILPY 232
            .:|||......| ::..|.:.:||. :.:|....|....|||...||:.....|||.|...|:||
Yeast   205 FQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPY 269

  Fly   233 INGINHVARIAAEADVETDLVKSCIQNLVYYGVVQLLPILKYSNVYMTQNL-KHLIQSASLSGAC 296
            |:|:|.:|:|:..::.:..||..||::|:||..|.|..|.::||:|...:| ::.:....::..|
Yeast   270 IDGLNSIAKISKLSNSDPGLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDC 334

  Fly   297 RKYVAL--------------------------------------RPD------------------ 305
            :.||..                                      .||                  
Yeast   335 QSYVTFPEVSKISNLPLNKSLGSGDQDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSL 399

  Fly   306 ------------------------------KTLPSVQRIFQFYASMTHGVTLRAICQR--LCPQH 338
                                          :.||:...:|..|.|::.|.||:...:.  :..:.
Yeast   400 NSSFSSIYKDWRQSQTSCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKE 464

  Fly   339 HNIDERRMVIFGLQHRFIRCIHKYPVFTGSVPSGRQKMYTGLISFD 384
            :|||.||.:.|||:.|.|...:.:||.. :..|...|..|.:|:.|
Yeast   465 NNIDIRRFITFGLEKRIIYRCYSFPVMI-NAGSREPKEMTPIITKD 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nprl2NP_573174.1 NPR3 40..403 CDD:305178 116/502 (23%)
NPR2NP_010852.4 NPR3 9..490 CDD:305178 110/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187354002
eggNOG 1 0.900 E1_KOG3789
Hieranoid 1 1.000
Homologene 1 1.000 H4771
Inparanoid 1 1.050 106 1.000 Inparanoid score I1393
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003867
OrthoInspector 1 1.000 T1136773
orthoMCL 1 0.900 OOG5_129933
Panther 1 1.100 LDO PTHR12991
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R837
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.