DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nprl2 and nprl2

DIOPT Version :8

Sequence 1:NP_573174.1 Gene:Nprl2 / 32677 FlyBaseID:FBgn0030800 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001039312.1 Gene:nprl2 / 559391 ZFINID:ZDB-GENE-060825-93 Length:379 Species:Danio rerio

Alignment Length:380 Identity:168/380 - (44%)
Similarity:241/380 - (63%) Gaps:6/380 - (1%)


  Fly    36 TEGKIRCIFLSEFHATAGCKISCQVPDNYISKDVFDAINVYIIPKQHLQRCILTVNAMDVKIVGY 100
            |..:|.|||.||||.|.|.||:.|||:.|||:::||.:.||||.|..||..::||.||:.|::|.
Zfish     3 TYRRIDCIFFSEFHPTLGPKITYQVPEEYISRELFDTVQVYIITKPELQNKLITVTAMEKKLIGC 67

  Fly   101 PVGIQDQQKYARNAFLFNLCFVCDSRARSVQYEPVVKKLSEYLIMMEEESCFLSREDDKRRLQNI 165
            ||.| :.:||.|||.||||..|||:..::...||:||||:.||..:|.||.|:|.|:.|::|..|
Zfish    68 PVCI-EHKKYRRNALLFNLGLVCDASTKTSALEPIVKKLAGYLTTLELESGFISNEESKQKLLPI 131

  Fly   166 FETVLRDLNERKVATI-VEGDNTIYLKIVMHKPDPPPVKDHMVPLLLANLRDAPLDNWDLTTQQI 229
            ..|:|.|||.....|: ::..|||:||::..:.||..|:::.||:...|........||||||||
Zfish   132 MSTLLEDLNITGACTLPIDDSNTIHLKLIEQRKDPLVVQEYDVPVFTKNKDHFIKSQWDLTTQQI 196

  Fly   230 LPYINGINHVARIAAEADVETDLVKSCIQNLVYYGVVQLLPILKYSNVY-MTQNLKHLIQSASLS 293
            ||:::|..|:.:|:||||||.:||:..:|||:||.||.|:.|.:||||| .|..:::||....|.
Zfish   197 LPFVDGYRHIQKISAEADVELNLVRIAVQNLLYYDVVTLVSIFQYSNVYCTTPKVQNLIDKKCLQ 261

  Fly   294 GACRKYVALRPDKTLPSVQRIFQFYASMTHGVTLRAICQRLCPQHHNIDERRMVIFGLQHRFIRC 358
            ..|..||:....:|  |::.:||.|..:|.|.|:|.:|.|...|...:|:|:::.|||....||.
Zfish   262 EECLHYVSKPGQRT--SLRDVFQLYCGLTPGTTVRDLCSRYSHQLQKVDDRKLIQFGLMKGLIRR 324

  Fly   359 IHKYPV-FTGSVPSGRQKMYTGLISFDEICCKTGLSPCTIERDIEKDTNVTVIWK 412
            :.|||| ......|...::|||..|:||||||||:|...::..:|.|.|:.|.||
Zfish   325 LQKYPVKVVRDERSRPPRLYTGCHSYDEICCKTGMSYKELDERLENDPNIVVCWK 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nprl2NP_573174.1 NPR3 40..403 CDD:305178 161/365 (44%)
nprl2NP_001039312.1 NPR3 5..369 CDD:305178 161/366 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187346473
eggNOG 1 0.900 E1_KOG3789
Hieranoid 1 1.000
Homologene 1 1.000 H4771
Inparanoid 1 1.050 317 1.000 Inparanoid score I2477
OMA 1 1.010
OrthoDB 1 1.010 D500740at2759
OrthoFinder 1 1.000 FOG0003867
OrthoInspector 1 1.000 T1054341
orthoMCL 1 0.900 OOG5_129933
Panther 1 1.100 LDO PTHR12991
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R837
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.