DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nprl2 and NPRL2

DIOPT Version :8

Sequence 1:NP_573174.1 Gene:Nprl2 / 32677 FlyBaseID:FBgn0030800 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_006536.3 Gene:NPRL2 / 10641 HGNCID:24969 Length:380 Species:Homo sapiens

Alignment Length:392 Identity:176/393 (45%)
Similarity:253/393 (64%) Gaps:16/393 (4%)


  Fly    24 GSGAGAAGAHGSTEGKIRCIFLSEFHATAGCKISCQVPDNYISKDVFDAINVYIIPKQHLQRCIL 88
            |||.           :|.|||.||||.|.|.||:.|||:::||:::||.:.||||.|..||..::
Human     2 GSGC-----------RIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLI 55

  Fly    89 TVNAMDVKIVGYPVGIQDQQKYARNAFLFNLCFVCDSRARSVQYEPVVKKLSEYLIMMEEESCFL 153
            ||.||:.|::|.||.| :.:||:|||.||||.||||::|::...||:||||:.||..:|.||.|:
Human    56 TVTAMEKKLIGCPVCI-EHKKYSRNALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELESSFV 119

  Fly   154 SREDDKRRLQNIFETVLRDLNERKVATI-VEGDNTIYLKIVMHKPDPPPVKDHMVPLLLANLRDA 217
            |.|:.|::|..|...:|.:||.....|: ::..|||:||::..:||||..:::.||:...:..|.
Human   120 SMEESKQKLVPIMTILLEELNASGRCTLPIDESNTIHLKVIEQRPDPPVAQEYDVPVFTKDKEDF 184

  Fly   218 PLDNWDLTTQQILPYINGINHVARIAAEADVETDLVKSCIQNLVYYGVVQLLPILKYSNVYM-TQ 281
            ....||||||||||||:|..|:.:|:||||||.:||:..||||:|||||.|:.||:|||||. |.
Human   185 FNSQWDLTTQQILPYIDGFRHIQKISAEADVELNLVRIAIQNLLYYGVVTLVSILQYSNVYCPTP 249

  Fly   282 NLKHLIQSASLSGACRKYVALRPDKTLPSVQRIFQFYASMTHGVTLRAICQRLCPQHHNIDERRM 346
            .::.|:...||..||..||..:..|. .|::.:||.|.|::.|.|:|.:..|...|..::|||::
Human   250 KVQDLVDDKSLQEACLSYVTKQGHKR-ASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVDERKL 313

  Fly   347 VIFGLQHRFIRCIHKYPV-FTGSVPSGRQKMYTGLISFDEICCKTGLSPCTIERDIEKDTNVTVI 410
            :.|||....||.:.|||| .|....|...::|||..|:||||||||:|...::..:|.|.|:.:.
Human   314 IQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIIC 378

  Fly   411 WK 412
            ||
Human   379 WK 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nprl2NP_573174.1 NPR3 40..403 CDD:305178 169/366 (46%)
NPRL2NP_006536.3 Interaction with PDPK1. {ECO:0000269|PubMed:18616680} 1..133 69/143 (48%)
NPR3 7..370 CDD:329240 168/365 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187337342
eggNOG 1 0.900 E1_KOG3789
Hieranoid 1 1.000
Homologene 1 1.000 H4771
Inparanoid 1 1.050 332 1.000 Inparanoid score I2394
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D500740at2759
OrthoFinder 1 1.000 FOG0003867
OrthoInspector 1 1.000 T1075086
orthoMCL 1 0.900 OOG5_129933
Panther 1 1.100 LDO PTHR12991
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R837
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.