DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Klk10

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:268 Identity:61/268 - (22%)
Similarity:107/268 - (39%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGLTAVGMCHAQGRIMGGE----DADATAT-------TFTASLRVDNAHVCGGSILSQTKILTT 64
            |:.|..|.:..||..::.|.    |.:|:..       .:..||..:....|.|.::.|..:||.
Mouse    21 LLPLLMVQLWAAQALLLPGNATRVDLEASGAQCERDYHPWQVSLFHNLQFQCAGVLVDQNWVLTA 85

  Fly    65 AHCVHRDGKLIDASRLACRVGSTN--QYAGGKIVNVESVAVHPDYYNLN----------NNLAVI 117
            |||...       ..|..|||..:  .:...::.:..|...||.|...:          ::|.::
Mouse    86 AHCWRN-------KPLRARVGDDHLLLFQKEQLRSTSSPVFHPKYQACSGPILPHRSDEHDLMML 143

  Fly   118 TLSSELTYTDRI--TAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQIS---LKVAPEAT 177
            .|||.:..|..:  ..:|...|     ..|.|..|:|||.::.....|. |.:|   :.:..:..
Mouse   144 KLSSPVMLTSNVHPVQLPFRCS-----QPGQECQVSGWGTSASRRVKYN-RSLSCSKVTLLSQKQ 202

  Fly   178 CLDAYSDHDEQS-FCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACG-SRYPDVFVRLSSY 240
            |...|......| .|...:..:.:|..|.||..:..:||.|:.::.:..|| :::|.|:..:..|
Mouse   203 CETFYPGVITNSMICAEADGNQDSCQSDSGGPLVCDDTLHGVLSWGIYPCGAAQHPSVYSEICKY 267

  Fly   241 ADWIQEQI 248
            ..||:..|
Mouse   268 TPWIRRVI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 52/223 (23%)
Tryp_SPc 42..244 CDD:214473 50/220 (23%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 50/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.