DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG17242

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:274 Identity:69/274 - (25%)
Similarity:119/274 - (43%) Gaps:69/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHR 70
            :::.|::.|.::....|..:.:|.|.|     .:.||:::::.|.|||.|.|:..|||.|.|| |
  Fly     1 MLLKGILLLVSIAQIAADFKSIGIEQA-----PWQASVQINDKHHCGGVIYSEDIILTIAECV-R 59

  Fly    71 DGKLIDASRLACRVGSTNQYAGGKIVNVES-----VAVHPDYYNLNNNLAVITLSSELTYTDRIT 130
            ..:|   ..::.||||..:.|||.::.||.     :.:.|      :::|::.|.|.|.....|.
  Fly    60 KARL---EFISVRVGSAQENAGGTVLKVEKMRLQVLGLRP------SDVAILQLRSPLYLDGGIR 115

  Fly   131 AIPLVASGEALP-AEGSEVIVAGWGRTSD-GTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLA 193
            ||||.    .:| ..|:...|:|||:.|. ..:|..:.::.:|:             .:|..|..
  Fly   116 AIPLA----TIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVKI-------------QDQLMCAT 163

  Fly   194 HELKEG------------------TCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSY 240
            :...:|                  .|.|..||..:..|.|.|:.:: ..||     ||..:.|.|
  Fly   164 NLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILSW-QSAC-----DVLNKSSVY 222

  Fly   241 AD------WIQEQI 248
            |:      ||:..:
  Fly   223 ANIAMFKVWIESTV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/235 (26%)
Tryp_SPc 42..244 CDD:214473 60/232 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 65/248 (26%)
Tryp_SPc 24..232 CDD:214473 63/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.