DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and PRSS1

DIOPT Version :8

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens

Alignment Length:257 Identity:68/258 (26%)
Similarity:118/258 (46%) Gaps:22/258 (9%)


  Fly     2 MQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAH 66
            |.| |:||..:............:|:||.:.:..:..:..||. ...|.||||::::..:::..|
Human   226 MNP-LLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLN-SGYHFCGGSLINEQWVVSAGH 288

  Fly    67 CVHRDGKLIDASRLACRVGSTN-QYAGG--KIVNVESVAVHPDY--YNLNNNLAVITLSSELTYT 126
            |.        .||:..|:|..| :...|  :.:|...:..||.|  ..|||::.:|.|||.....
Human   289 CY--------KSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN 345

  Fly   127 DRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSY--KIRQISLKVAPEATCLDAYSDH-DEQ 188
            .|::.|.|..   |.||.|::.:::|||.|:.....|  :::.:...|..:|.|..:|... ...
Human   346 ARVSTISLPT---APPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSN 407

  Fly   189 SFCLAH-ELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249
            .||:.. |..:.:|.||.||..:....|.|:.::..|......|.|:.::.:|..||:..||
Human   408 MFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIA 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/214 (27%)
Tryp_SPc 42..244 CDD:214473 57/211 (27%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 60/228 (26%)
Tryp_SPc 249..467 CDD:238113 61/230 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.