DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG5255

DIOPT Version :8

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster

Alignment Length:262 Identity:72/263 (27%)
Similarity:121/263 (46%) Gaps:28/263 (11%)


  Fly     6 LVILGLIGLTAVGMC-------HAQGRIMGGEDADATATTFTASLR--VDNAHVCGGSILSQTKI 61
            |::|.|:..|:....       :.:.||:|||:|.|....:..||:  ...||.|||:|:.:..|
  Fly     3 LILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67

  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELT 124
            :|.|||..  |:...|.|:.......:| .|.|....:.:..|.:|  ....|::|::.|:..:.
  Fly    68 ITAAHCTR--GRQATAFRVLTGTQDLHQ-NGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIV 129

  Fly   125 YTDRITAIPLVASGEALPAEGSEVIVAGWGRTS-DGTNSYKIRQISLKVAPEATCLDAYSDHDEQ 188
            : |..|. |:....||| ..||.:::.|||..| .|....:::.:.:...|...|..|   ||..
  Fly   130 F-DNATQ-PVELDHEAL-VPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAA---HDNS 188

  Fly   189 S------FCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQ 247
            :      .|..::...|.||||.||..::...|:.|.|:.: .|...|||....:|.|.|:|:..
  Fly   189 TRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGL-PCAKGYPDAHASISYYHDFIRTH 252

  Fly   248 IA 249
            ::
  Fly   253 LS 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/216 (28%)
Tryp_SPc 42..244 CDD:214473 60/213 (28%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 67/230 (29%)
Tryp_SPc 30..252 CDD:238113 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50761
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469244at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.