| Sequence 1: | NP_573148.2 | Gene: | sphe / 32648 | FlyBaseID: | FBgn0030774 | Length: | 249 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001138068.1 | Gene: | CG31266 / 42071 | FlyBaseID: | FBgn0051266 | Length: | 282 | Species: | Drosophila melanogaster |
| Alignment Length: | 292 | Identity: | 79/292 - (27%) |
|---|---|---|---|
| Similarity: | 120/292 - (41%) | Gaps: | 80/292 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 VILGLIGLTAVGMCHA------------------------QGRIMGGEDADATATTFTASLRVDN 47
Fly 48 A---HVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYN 109
Fly 110 L---------------------NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGW 153
Fly 154 GRT-SDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSF---CLAHELKEGTCHGDGGGGAI-YGN 213
Fly 214 TLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sphe | NP_573148.2 | Tryp_SPc | 42..247 | CDD:238113 | 65/233 (28%) |
| Tryp_SPc | 42..244 | CDD:214473 | 63/230 (27%) | ||
| CG31266 | NP_001138068.1 | Tryp_SPc | 51..272 | CDD:214473 | 68/247 (28%) |
| Tryp_SPc | 52..275 | CDD:238113 | 69/249 (28%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG25816 | |
| OrthoDB | 1 | 1.010 | - | - | D469244at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.930 | |||||