DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and modSP

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:206 Identity:50/206 - (24%)
Similarity:80/206 - (38%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGEDADATATTFTASLRV-----DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGST 87
            ||...:.|...:...|.|     |....||||:|:...::|.||||:.:|..:..|....||.:.
  Fly   371 GGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAA 435

  Fly    88 NQYAG-------GKIVNVESVAVHPDY----YNLNNNLAVITLSS--ELTYTDRITAIPLVASGE 139
            ..|..       .|..:|..:.:.|.|    .|...:||::||..  ||::..|...:...:..|
  Fly   436 KFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAE 500

  Fly   140 ALPAEGSEVIV-------AGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELK 197
                  .|.:.       |||    :..|.::::.:.......:.|.....|.....||:..:.|
  Fly   501 ------KESVTDDVQGKFAGW----NIENKHELQFVPAVSKSNSVCRRNLRDIQADKFCIFTQGK 555

  Fly   198 EGTCHGDGGGG 208
            ...|.||.|||
  Fly   556 SLACQGDSGGG 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 47/192 (24%)
Tryp_SPc 42..244 CDD:214473 47/192 (24%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 50/206 (24%)
Tryp_SPc 371..591 CDD:304450 50/206 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.