DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG8329

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:266 Identity:65/266 - (24%)
Similarity:108/266 - (40%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPRLVILGLIGLTAVGMCHAQGR-------------IMGGEDADATATTFTASLRVDNAHVCGG 53
            |..:||:|.|...|   :|..:.|             |:.|..|......:...||::|..|.||
  Fly     1 MSKKLVLLLLFVAT---VCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGG 62

  Fly    54 SILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAG--GKIVNVESVAVHPDYYNLNNNLAV 116
            |::....:||.|||:..|...|       ..||...:.|  ...||..:...||.|.|...:...
  Fly    63 SVIGNNWVLTAAHCLTTDSVTI-------HYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIG 120

  Fly   117 ITLSSELTYTDRITAIPL---VASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATC 178
            :..:..:::|:.|..:.|   ...||..  |....:..|||..::|..:..::.:.::|.....|
  Fly   121 LIRTPYVSFTNLINKVSLPKFSQKGERF--ENWWCVACGWGGMANGGLADWLQCMDVQVISNGEC 183

  Fly   179 LDAYSDHDEQSFCLAHELKEGTCHGDGGGGAI-YGNTL-IGLTNFVVGACGSRYPDVFVRLSSYA 241
            ..:|........|......:..|.||.||..: :.|.: :|:..|....|.|. |..:.|:|.:.
  Fly   184 ARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSG-PSGYTRVSDHL 247

  Fly   242 DWIQEQ 247
            |||:|:
  Fly   248 DWIREK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/211 (25%)
Tryp_SPc 42..244 CDD:214473 51/208 (25%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 56/227 (25%)
Tryp_SPc 35..250 CDD:214473 54/224 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.