DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG6592

DIOPT Version :8

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster

Alignment Length:256 Identity:63/257 (25%)
Similarity:111/257 (43%) Gaps:44/257 (17%)


  Fly    22 AQGRIMGGEDADATATTFTASL---RVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACR 83
            |..||.||:..:.....:...:   |....:.||||::|...::|.||||       |.::.|..
  Fly   119 AMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV-------DMAKRALV 176

  Fly    84 VGSTNQYAGGK-------IVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVASGE 139
            ....|:....|       :|..|:..::|.:  ..|.:::|::.|...:::.:||..|       
  Fly   177 FLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPI------- 234

  Fly   140 ALPAEGSE--------VIVAGWGRTSDGTN--SYKIRQISLKVAPEATCLDAYS-DHDEQSFCLA 193
            .||....|        .|.:||||.:.|.:  |..:|.:.|::....||...:. .:...:.|.:
  Fly   235 QLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTS 299

  Fly   194 HELKEGTCHGDGGGGAIY------GNTLIGLTNF-VVGACGSRYPDVFVRLSSYADWIQEQ 247
            ......||:||.||..:.      ...|:|:|:| .:..|...||..|.:::||.|||.::
  Fly   300 GRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDE 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/235 (25%)
Tryp_SPc 42..244 CDD:214473 57/232 (25%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 61/249 (24%)
Tryp_SPc 123..359 CDD:238113 61/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C142361824
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.