DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG32271

DIOPT Version :8

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster

Alignment Length:251 Identity:68/252 (27%)
Similarity:117/252 (46%) Gaps:19/252 (8%)


  Fly     7 VILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRD 71
            ::|.||.|.......|..||:||...|..:..:..:||:....:||||:::...::|.||||   
  Fly     6 LVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCV--- 67

  Fly    72 GKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYN---LNNNLAVITLSSELTYTDRITAIP 133
             |.|.|||:....|.|.....|....|:.|.. |..||   |.:::||:.|.:.:: ..:::.|.
  Fly    68 -KGIGASRILVVAGVTRLTETGVRSGVDKVYT-PKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIE 129

  Fly   134 LV-ASGEALPAEGSEVIVAGWGRTSDGTN--SYKIRQISLKVAPEATCLDAY---SDHDEQSFCL 192
            |. .|.:|    |..:.|:|||:.::...  |.::|.:.:.:.|...|:..|   .......||.
  Fly   130 LCNTSFKA----GDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCA 190

  Fly   193 AHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248
            :....:..|.||.||.|:|...|.|:.::.||......|.|:..:.:...:|.:.:
  Fly   191 SVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/214 (27%)
Tryp_SPc 42..244 CDD:214473 57/211 (27%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 62/228 (27%)
Tryp_SPc 25..244 CDD:238113 62/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469244at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24276
RoundUp 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.