DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG9897

DIOPT Version :8

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_611744.1 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:247 Species:Drosophila melanogaster

Alignment Length:263 Identity:65/264 (25%)
Similarity:111/264 (42%) Gaps:41/264 (16%)


  Fly     1 MMQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTA 65
            |:.| |::|.::.|..:.:  ...||:.|...:.....:.||:.|::...|||:|:|:..|||.|
  Fly     1 MLAP-LILLQIVALPWLAL--GDQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAA 62

  Fly    66 HCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDR 128
            .||  ||  ..|..:..|:|:::....|.|..:..|.||..|  :..:||||::.....|..||.
  Fly    63 KCV--DG--YSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLNTTDE 123

  Fly   129 ITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNS------YKIRQISLKVAPEATC--------- 178
            |..|   ...:.:|.:.|..     .|.|.|...      .::....:::..:..|         
  Fly   124 IKPI---ERADKVPDDNSRA-----NRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKVIPF 180

  Fly   179 --LDAYSDHDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYA 241
              |...||   .:.|.....| |.|..|.|...:..|.|:|:.:  ...|..: |||:..:..:.
  Fly   181 YLLKGISD---LTICTKSPGK-GACSTDRGSPLVIDNKLVGILS--RAGCSIK-PDVYANILGHT 238

  Fly   242 DWI 244
            :|:
  Fly   239 NWL 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 56/223 (25%)
Tryp_SPc 42..244 CDD:214473 56/221 (25%)
CG9897NP_611744.1 Tryp_SPc 22..240 CDD:214473 59/237 (25%)
Tryp_SPc 23..244 CDD:238113 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24276
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.