DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG8952

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:270 Identity:76/270 - (28%)
Similarity:127/270 - (47%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAVGM---------CHAQGRIMGGEDADATATTFTASLRVD--NAHVCGGSILSQT 59
            |:::.|..::.||.         .....||:.|.||......:...|:.|  :..:|||||:|.|
  Fly     9 LMLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDT 73

  Fly    60 KILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVES--VAVHPDYYN-LNNNLAVITLSS 121
            .:||.|||.:      ..|.:....|:.:.: ....:|:.|  :.:||||.: |||::::|.|..
  Fly    74 WVLTAAHCTN------GLSSIFLMFGTVDLF-NANALNMTSNNIIIHPDYNDKLNNDVSLIQLPE 131

  Fly   122 ELTYTDRITAIPLVAS-GEALPAEGSEVIVAGWGRTSDGTNSYK--IRQISLKVAPEATCLDAYS 183
            .||::..|.||.||.. |:::...||...:||:|.|.|....|.  :....:::...|.|:..|.
  Fly   132 PLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYG 196

  Fly   184 DHDEQSFCLAHELKEG----TCHGDGGGGAI-YGNTL-----IGLTNFVV-GACGSRYPDVFVRL 237
            .:......:..:..:|    ||.||.||..| |..|:     ||:.:||. ..|..|.|..:.|:
  Fly   197 KYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARV 261

  Fly   238 SSYADWIQEQ 247
            ||:..:|.::
  Fly   262 SSFLGFIADK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 67/223 (30%)
Tryp_SPc 42..244 CDD:214473 66/220 (30%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 71/237 (30%)
Tryp_SPc 38..271 CDD:238113 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.