DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG32755

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:243 Identity:64/243 - (26%)
Similarity:110/243 - (45%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTASLRVDN--------AHVCGGSILSQTKILTTAHC---------VHRDG 72
            :|:||.........|..|:|..:        .|||||:::||..:.:.|||         |:||.
  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101

  Fly    73 KLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTY-TDRITAIPL 134
            :|......:..:..|:::....:  |:.:..|.||  ..|.|::|::.|:..:.: :..:.||||
  Fly   102 ELYVVVAGSSAIDRTDRFTQEYL--VQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPL 164

  Fly   135 VASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEG 199
            ....   |.||:..::.|||:.:....|..::|..:.:..:..|...|.....| .| |..|:.|
  Fly   165 AIKA---PEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYKLPASQ-MC-AGFLQGG 224

  Fly   200 --TCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245
              .|.||.||..|....|.|:.::.||.....||.|:..:|.:..||:
  Fly   225 IDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 60/226 (27%)
Tryp_SPc 42..244 CDD:214473 58/223 (26%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 62/240 (26%)
Tryp_SPc 38..273 CDD:238113 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.