DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Klk15

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:243 Identity:61/243 - (25%)
Similarity:103/243 - (42%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTN- 88
            :::.||:....:..:..:|.......||..::|...:||.|||..|        .:..|:|..| 
Mouse    19 KVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLTAAHCQTR--------FMRVRLGEHNL 75

  Fly    89 -QYAG-GKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITA-IPLVASGEALPAEGSEVIV 150
             ::.| .::.:|..:..||.|....:...::.|  .|....|:|| :..||.....|..|.:.:|
Mouse    76 RKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLL--RLFKPARLTAYVRPVALPRRCPLIGEDCVV 138

  Fly   151 AGWGRTSD----GTNSYK--------IRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEGT--C 201
            :|||..||    .|.|.|        :...::.:..||:|...|......:...|.....||  |
Mouse   139 SGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCNKDYPGRVLPTMVCAGVEGGGTDSC 203

  Fly   202 HGDGGGGAIYGNTLIGLTNFVVGACG-SRYPDVFVRLSSYADWIQEQI 248
            .||.||..:.|..|.|:.::....|. :..|.|:.::.||.:||.|.:
Mouse   204 EGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLEWIWENV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/223 (26%)
Tryp_SPc 42..244 CDD:214473 56/220 (25%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 58/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.