DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prtn3

DIOPT Version :8

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001019435.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:254 Species:Rattus norvegicus

Alignment Length:279 Identity:69/280 (25%)
Similarity:111/280 (40%) Gaps:80/280 (29%)


  Fly     2 MQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASL---RVDNAHVCGGSILSQTKILT 63
            |.|.|    |:.|...|...| .:|:||.:|...:..:.|||   |...:|.|||:::....:||
  Rat    11 MHPFL----LLALVFGGAVQA-SKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLT 70

  Fly    64 TAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNV-----ESVAVHPDY------------YNLN 111
            .|||:                    |....::|.|     :.::..|:.            ||..
  Rat    71 AAHCL--------------------QDISWQLVTVVLGAHDLLSSEPEQQKFTITQVFENNYNPE 115

  Fly   112 ---NNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVA 173
               |::.::.|:...:...::....|....::| ::|::.:..||||.  ||.           |
  Rat   116 ETLNDVLLLQLNRPASLGKQVAVASLPQQDQSL-SQGTQCLAMGWGRL--GTR-----------A 166

  Fly   174 PEATCLDAYSDHD-----------EQSFC-LAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGAC 226
            |....|     |:           |.:.| |......|.|.||.||..|....|.|:.:||:..|
  Rat   167 PTPRVL-----HELNVTVVTFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIREC 226

  Fly   227 GS-RYPDVFVRLSSYADWI 244
            .| ::||.|.|:|.|.:||
  Rat   227 ASLQFPDFFARVSMYVNWI 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/240 (24%)
Tryp_SPc 42..244 CDD:214473 56/238 (24%)
Prtn3NP_001019435.1 Tryp_SPc 29..245 CDD:214473 61/255 (24%)
Tryp_SPc 30..248 CDD:238113 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.