| Sequence 1: | NP_573148.2 | Gene: | sphe / 32648 | FlyBaseID: | FBgn0030774 | Length: | 249 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001099722.1 | Gene: | Klk11 / 292849 | RGDID: | 1308690 | Length: | 279 | Species: | Rattus norvegicus |
| Alignment Length: | 271 | Identity: | 65/271 - (23%) |
|---|---|---|---|
| Similarity: | 110/271 - (40%) | Gaps: | 51/271 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MMQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTA 65
Fly 66 HC----------VHR----DGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNL------ 110
Fly 111 NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDG--TNSYKIRQISLKVA 173
Fly 174 PEATCLDAYSDHDEQSFCLAHELKEG--TCHGDGGGGAIYGNTLIGLTNFVVGACG-SRYPDVFV 235
Fly 236 RLSSYADWIQE 246 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sphe | NP_573148.2 | Tryp_SPc | 42..247 | CDD:238113 | 56/230 (24%) |
| Tryp_SPc | 42..244 | CDD:214473 | 53/226 (23%) | ||
| Klk11 | NP_001099722.1 | Tryp_SPc | 50..272 | CDD:214473 | 56/243 (23%) |
| Tryp_SPc | 51..275 | CDD:238113 | 58/246 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D469244at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||