DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Klk11

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:271 Identity:65/271 - (23%)
Similarity:110/271 - (40%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTA 65
            ||..|.:.|.|:    .|....:.||:.|.:....:..:..:|......:||.::::...:||.|
  Rat    30 MMILRFIALALV----TGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAA 90

  Fly    66 HC----------VHR----DGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNL------ 110
            ||          .|.    ||  .:..|:|                .||.. ||.:.|.      
  Rat    91 HCRKPHYVILLGEHNLEKTDG--CEQRRMA----------------TESFP-HPGFNNSLPNKDH 136

  Fly   111 NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDG--TNSYKIRQISLKVA 173
            .|::.::.:||....|..:.  ||..|...:.| |:..:::|||.||..  ...:.:|..::.:.
  Rat   137 RNDIMLVKMSSPAFITRAVR--PLTLSSLCVTA-GTSCLISGWGTTSSPQLRLPHSLRCANVSII 198

  Fly   174 PEATCLDAYSDHDEQSFCLAHELKEG--TCHGDGGGGAIYGNTLIGLTNFVVGACG-SRYPDVFV 235
            ....|..||..:...:...|...|||  :|.||.||..:...:|.|:.::....|. :|.|.|:.
  Rat   199 GHKECERAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYT 263

  Fly   236 RLSSYADWIQE 246
            ::..|.|||.|
  Rat   264 KVCKYFDWIHE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 56/230 (24%)
Tryp_SPc 42..244 CDD:214473 53/226 (23%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 56/243 (23%)
Tryp_SPc 51..275 CDD:238113 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.