DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prss29

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:280 Identity:77/280 - (27%)
Similarity:123/280 - (43%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILG--LIGLTA-------VGMCHAQGRIMGGEDADATATTFTASLRVDN------AHVCGGSI 55
            |:.||  :.|:.|       ||       |:||..|......:..||||..      .|:|||||
  Rat     9 LIFLGSSIAGIPASVPEDVLVG-------IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSI 66

  Fly    56 LSQTKILTTAHCVHRDGKLIDASRLACRV--GSTNQYAGGKIVNVESVAVHPDYY--NLNNNLAV 116
            :....:||.|||:|..    ||...|.|:  |....|.|.|::.|..|.:|||:.  .|.:::|:
  Rat    67 IHPQWVLTAAHCIHES----DADPSAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVAL 127

  Fly   117 ITLSSELTYTDRITAIPLVASGEALPAEGSEVI-VAGWGRTSDGTN---SYKIRQISLKVAPEAT 177
            :.|:..:.....:.  |:..|..:|.....:|. |.|||..|...:   .|:::|:.:|:.....
  Rat   128 LQLAQSVRSFPNVK--PVKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTL 190

  Fly   178 CLDAY------SDHDE----QSFCLAHELKEGTCHGDGGGGA---IYGN-TLIGLTNFVVGACGS 228
            |...|      |:|.:    |....|......:|:||.||..   :.|: ||:|:.::..|....
  Rat   191 CEKLYRNATRLSNHGQRLILQDMLCAGSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALK 255

  Fly   229 RYPDVFVRLSSYADWIQEQI 248
            ..|.|:.|:..:..||..|:
  Rat   256 DIPGVYARVQFFLPWITGQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 65/232 (28%)
Tryp_SPc 42..244 CDD:214473 63/229 (28%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.