DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Sp212

DIOPT Version :8

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster

Alignment Length:222 Identity:62/223 (28%)
Similarity:101/223 (45%) Gaps:30/223 (13%)


  Fly    48 AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG--STNQYA--GGKIVNVESVAVHPDY- 107
            |..|.||::|.:.:::.||||||    :...|:...:|  ..:.|.  |.::.||..:..|||| 
  Fly   303 AFKCRGSLISSSIVISAAHCVHR----MTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYN 363

  Fly   108 ---YNLNNNLAVITLSSELTYTDRITAIPL--VASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQ 167
               |: :.::|:||:...:|:.|.|..|.:  |.:...:...|   .:|||||..|.:.:...|.
  Fly   364 TRSYS-DADIALITIERPVTFNDIIAPICMWTVEASRTVSTTG---FIAGWGRDEDSSRTQYPRV 424

  Fly   168 ISLKVAPEATCLDAYSDH--DEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRY 230
            :..::|....|...:...  .|:|.|..:....|.|.||.|||.:.......|...:|.| |.|.
  Fly   425 VEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSA-GERG 488

  Fly   231 PD---------VFVRLSSYADWIQEQI 248
            |.         ::..||.:.:||.|.|
  Fly   489 PAGTCQLNQYVLYCDLSKHINWISENI 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/220 (28%)
Tryp_SPc 42..244 CDD:214473 59/217 (27%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 61/220 (28%)
Tryp_SPc 277..511 CDD:214473 59/217 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50752
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.