powered by:
                  
 
    
 
    
             
          
            Protein Alignment sphe and CG43125
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_573148.2 | 
            Gene: | sphe / 32648 | 
            FlyBaseID: | FBgn0030774 | 
            Length: | 249 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_001247344.1 | 
            Gene: | CG43125 / 12798281 | 
            FlyBaseID: | FBgn0262588 | 
            Length: | 258 | 
            Species: | Drosophila melanogaster | 
          
        
        
        
          
            | Alignment Length: | 95 | 
            Identity: | 22/95 - (23%) | 
          
          
            | Similarity: | 43/95 -  (45%) | 
            Gaps: | 24/95 - (25%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    51 CGGSILSQTKILTTAHCV-----------HRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVH 104 
            |.|:::::..:||.|.|:           ..||.|.::|:|        ||   :.:.|....:| 
  Fly    52 CTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKL--------QY---EEIYVARALIH 105 
 
  Fly   105 PDYYNLNN--NLAVITLSSELTYTDRITAI 132 
            ..|.:.::  |:|::.|.:.:.|...|..| 
  Fly   106 RSYSSESHQYNIALLRLKTSVVYKKNIQPI 135 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            1 | 
            0.930 | 
            - | 
            - | 
             | 
            C45436545 | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 0.930 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.