DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Klk9

DIOPT Version :8

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus

Alignment Length:254 Identity:61/255 (24%)
Similarity:109/255 (43%) Gaps:31/255 (12%)


  Fly    12 IGLTAV------GMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHR 70
            :|||.|      |.|.|..|.:|..:....:..:.|.|......:||.::::...:||.|||   
Mouse     3 LGLTLVLFSLLAGHCGADTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHC--- 64

  Fly    71 DGKLIDASRLACRVGSTN--QYAG-GKIVNVESVAVHPDY------YNLNNNLAVITLSSELTYT 126
                 ....|..|:|..:  ::.| .:::.|.....||.:      .:.|:::.:|.|..::..|
Mouse    65 -----RKPYLWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLT 124

  Fly   127 DRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSY--KIRQISLKVAPEATCLDAYSDH-DEQ 188
            ..:..:.|.   |:.|..|::.:::|||..|.....|  .::..::.:.....|..||..| .|:
Mouse   125 PAVQPLNLT---ESRPPVGTQCLISGWGSVSSSKLQYPMTLQCANISILDNKLCRWAYPGHISEK 186

  Fly   189 SFCLA-HELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACG-SRYPDVFVRLSSYADWIQ 245
            ..|.. .|...|:|.||.||..:...||.|:.:.....|. .|.|.|:..:..|.:||:
Mouse   187 MLCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIE 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 51/219 (23%)
Tryp_SPc 42..244 CDD:214473 50/216 (23%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 53/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.