DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33160 and zgc:112038

Sequence 1:NP_788456.1 Gene:CG33160 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio

Alignment Length:211 Identity:76/212 (36%)
Similarity:112/212 (53%) Gaps:13/212 (6%)


  Fly    50 QVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQAG--PYAVIRTVDYIAIRPDFN 112
            :::..:.:|||||:...||::||||.......:.||:.|...|.|  |..:.||:..|.|.||::
Zfish    54 RISPEDHICGGSLINKDWVLSAAHCFMITATANIKIFLGRQFQTGSNPNEISRTLTQIVIHPDYS 118

  Fly   113 RKTLNMDVAALRLNSDMIGAN-IETIPLA-AQSVPARALVK-VSGWGFLTADATKTAERVHSVLV 174
            ..|.|.|:|.|||:|.:...: |..:.|| |.||.|..... ::||....:...:....:..|.:
Zfish   119 TTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQL 183

  Fly   175 PMWSRASCVSAFRGIHRITRSMVCAA-RLYKKDSCDGDSGGPLV----YRGQLAGIVSFGYGCA- 233
            |:.|...|.:.::||  ||.:|:||. ....||:|.||||||:|    .|...:||||||..|. 
Zfish   184 PVVSNTECNADYKGI--ITDNMICAGINEGGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECGL 246

  Fly   234 SALPGIYTSVPEIRDW 249
            ...|||||.|.:.:.|
Zfish   247 PRYPGIYTRVSQYQSW 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 75/210 (36%)
Tryp_SPc 34..253 CDD:238113 76/212 (36%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 76/212 (36%)
Tryp_SPc 37..263 CDD:238113 76/212 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.