DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33160 and CG9733

Sequence 1:NP_788456.1 Gene:CG33160 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster

Alignment Length:277 Identity:79/278 (28%)
Similarity:124/278 (45%) Gaps:45/278 (16%)


  Fly    19 SAVYAHPDS---VQIQPRIIGGHVSSIKEEKYLVQVTTSEE-------LCGGSLVKPRWVITAAH 73
            |::...|.|   |.|:.||..|..:.:.|..::|.:.....       .|.|||:..|:|:||||
  Fly   144 SSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAH 208

  Fly    74 CVYNK-------------NKNDFKIY-----GGASNQAGPYAVIRTVDYIAIRPDFNRKTLNM-- 118
            |:..:             .::|.:..     ||.|  ..|.......:.|.:...::.|..|.  
  Fly   209 CLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGS--CSPEVQRLGFEEIRVHERYSEKASNQVH 271

  Fly   119 DVAALRLNSDM-IGANIETIPLAA----QSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWS 178
            |:..:|:..:: ...||:.|.|.:    :|..:.....|:||| .|....::|.: ..|.|....
  Fly   272 DIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWG-RTLKMARSAVK-QKVTVNYVD 334

  Fly   179 RASCVSAFRGIH-RITRSMVCAARLYKKDSCDGDSGGPLV-YRGQ---LAGIVSFGYGCA-SALP 237
            .|.|...|..|. .:..:.:||...::||||||||||||: :|.:   |.|||||||.|. ...|
  Fly   335 PAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWP 399

  Fly   238 GIYTSVPEIRDWFQRVV 254
            |:||:|.....|.::.|
  Fly   400 GVYTNVAAYDIWIRQNV 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/254 (28%)
Tryp_SPc 34..253 CDD:238113 72/257 (28%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 73/255 (29%)
Tryp_SPc 162..415 CDD:238113 72/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.