DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33160 and CG14892

Sequence 1:NP_788456.1 Gene:CG33160 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster

Alignment Length:377 Identity:77/378 (20%)
Similarity:115/378 (30%) Gaps:164/378 (43%)


  Fly    32 PRIIGGHVSSIKEEKYLVQVTTSEEL-----------CGGSLVKPRWVITAAHCVYNK------- 78
            ||||.|  ::..|.::..|  .|.||           ||..|:...|:::|||||:|.       
  Fly    79 PRIIAG--AATNEGQFPWQ--ASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIP 139

  Fly    79 -------NKNDFKIYGG------------------------------------ASN--------- 91
                   .::|..:..|                                    |||         
  Fly   140 PLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRYHNFKHDVVLMKLSKPADLTRASNIRRICLPFL 204

  Fly    92 ------QAGPYAV---------------------------IRTVD----YIAIRPDFNRKTLNMD 119
                  ||....|                           :|:|.    |..:.....::.:||.
  Fly   205 LAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMK 269

  Fly   120 V-----------------AALRLNSDM--IGANIETIPLAAQSVPARALVKVS------------ 153
            :                 .:.|.|..:  :|...::...|.|..|     |||            
  Fly   270 ILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHP-----KVSDEPKEIAFVDCV 329

  Fly   154 --GWGFLTADATKTAERVHSVL---VPMWSRASCVSAFRGIHRITRSMVCAARLY-KKDSCDGDS 212
              |||    .|..:.:..:.:|   ||:.....|..|:.....|....:||.:|. :..:|.|||
  Fly   330 ATGWG----KANISGDLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDS 390

  Fly   213 GGPLVYRGQ------LAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVEQH 257
            ||||..|..      |.|:.|||.||| ...|.:||.......|.:..:..|
  Fly   391 GGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTIATH 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/367 (20%)
Tryp_SPc 34..253 CDD:238113 74/370 (20%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 75/368 (20%)
Tryp_SPc 81..438 CDD:238113 74/370 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.