DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG6865

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:296 Identity:85/296 - (28%)
Similarity:137/296 - (46%) Gaps:61/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGF------HSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQ-VTTSEELCGGSLV 63
            |..:|:|.:|..      ..|....|.||: .|:|:||..:...|..|:|. :......|||:::
  Fly     2 LKIVFVVAVLSLVKCAQSQIAFSNQPCSVR-NPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTII 65

  Fly    64 KPRWVITAAHCVYNKNKNDFK---IYG------------GASNQAGPYAVIRTVDY--IAIRPDF 111
            ..||::||.||:.|..:...|   |.|            |..|  ||.|:  .||:  |...|.:
  Fly    66 SERWILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGN--GPDAL--RVDFKNIVPHPQY 126

  Fly   112 NRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPA--------RALVK----VSGWGFLTADATK 164
            :...:..|:|.|.|        ::.|..::...|:        |:|.:    |||||:...:..:
  Fly   127 DCNDVKHDIALLEL--------VQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAE 183

  Fly   165 T--AERVHSVLVPMWSRASCVSAFRGI---HRITRSMVCAARLYKK---DSCDGDSGGPLVYR-G 220
            .  ::.:....|.:|:..:|..::|.:   :.|..:.:||.  |:.   |||..||||||:.: .
  Fly   184 NDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAG--YENGQIDSCWADSGGPLMSKEH 246

  Fly   221 QLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVE 255
            .|.|:||.|.||| ..||||||.|.:...|.|:|::
  Fly   247 HLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVID 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 73/255 (29%)
Tryp_SPc 34..253 CDD:238113 75/258 (29%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 73/255 (29%)
Tryp_SPc 35..280 CDD:238113 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.