DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33160 and CG4613

Sequence 1:NP_788456.1 Gene:CG33160 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster

Alignment Length:246 Identity:82/247 (33%)
Similarity:126/247 (51%) Gaps:49/247 (20%)


  Fly    33 RIIGGHVSSIKEEKY--LVQVTTSEEL-CGGSLVKPRWVITAAHCVYNKNKNDFKI----YGGAS 90
            ||:||  :.::..||  :.|:.....| |||:|:..|:|:||||||:..:.....:    ...:|
  Fly   136 RIVGG--TQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSS 198

  Fly    91 NQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPA--------- 146
            ...|   |.|:|.:......::..:|..|:|.|||:        :.|||.....||         
  Fly   199 THLG---VTRSVAFAHAHVGYDPVSLVHDIALLRLD--------QPIPLVDTMRPACLPSNWLQN 252

  Fly   147 ----RALVKVSGWGFLTADATKTAERVHSVLVPMWSRASC-VSAFRGIHRITRSMVCAARLYKK- 205
                :|:  |:||| |:.:...|:..:..|:||:.:.|.| .:::|.:  |..:|:||.  |.| 
  Fly   253 FDFQKAI--VAGWG-LSQEGGSTSSVLQEVVVPIITNAQCRATSYRSM--IVDTMMCAG--YVKT 310

  Fly   206 ---DSCDGDSGGPLVYRG---QLAGIVSFGYGCASA-LPGIYTSVPEIRDW 249
               |:|.|||||||:.|.   :|||:||||||||.. .||:||.|....:|
  Fly   311 GGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEW 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 81/245 (33%)
Tryp_SPc 34..253 CDD:238113 81/246 (33%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 82/247 (33%)
Tryp_SPc 137..362 CDD:238113 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.