DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33160 and CG32269

Sequence 1:NP_788456.1 Gene:CG33160 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster

Alignment Length:229 Identity:93/230 (40%)
Similarity:132/230 (57%) Gaps:2/230 (1%)


  Fly    27 SVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASN 91
            |.:||.||:||..::|....|:||:.....||.|||:..:||:||||||...:.:||.:.||.:.
  Fly   102 SSKIQSRIVGGTSTTISTTPYIVQLRRGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTT 166

  Fly    92 QAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARALVKVSGWG 156
            ..|...|.|:|..|.:.|.|..|.:|||.|.|:||..:.|.||.||.:......|.:.|:::|||
  Fly   167 LDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIAGWG 231

  Fly   157 FLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQ 221
            .....:|..::.:.:..:.:..:..|...:||...||:.|:| ||...||||.||||||:.....
  Fly   232 VTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLC-ARAAGKDSCSGDSGGPVTRNNT 295

  Fly   222 LAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVV 254
            |.||||||||||.| .||:||:|..||.|...::
  Fly   296 LLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIM 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 89/217 (41%)
Tryp_SPc 34..253 CDD:238113 89/220 (40%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 89/217 (41%)
Tryp_SPc 121..324 CDD:238113 84/204 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C185598995
eggNOG 1 0.900 E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.