DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG40160

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:220 Identity:65/220 - (29%)
Similarity:100/220 - (45%) Gaps:29/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CGGSLVKPRWVITAAHCVYNKNKNDFKIYGG-----ASNQAGPYAVIRTVDYIAIRPDFNRKTLN 117
            |.|||:..:.|:||||||.:.....|.:..|     ...:..||.. |:|..:.:.||:||:::.
  Fly   192 CAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQE-RSVQTVILHPDYNRRSIA 255

  Fly   118 MDVAALRLNSDM-IGANIETIPLAAQ-SVPARALVKVS-GWGFLTADATKTAERVHSVL----VP 175
            .|.|.:.|:..: :..:|..|.|..| .:|.......| |||   .||..:..:..|::    :|
  Fly   256 YDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWG---KDAFGSLGKYSSLMKRVPLP 317

  Fly   176 MWSRASCVSAFRGIH-----RITRSMVCAARLYKKDSCDGDSGGPLV--------YRGQLAGIVS 227
            :....||.:..||..     .:.||.:||......|:|.||.|.||.        .|.|..|||:
  Fly   318 IVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVA 382

  Fly   228 FGYGCASALPGIYTSVPEIRDWFQR 252
            :|.||...:|..|.:|..:|.|..:
  Fly   383 WGIGCNDEVPAAYANVALVRGWIDQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 64/215 (30%)
Tryp_SPc 34..253 CDD:238113 65/220 (30%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 65/220 (30%)
Tryp_SPc 169..405 CDD:214473 64/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.