DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33160 and CG33159

Sequence 1:NP_788456.1 Gene:CG33160 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster

Alignment Length:230 Identity:88/231 (38%)
Similarity:130/231 (56%) Gaps:10/231 (4%)


  Fly    33 RIIGGHVSSIKEEKYLVQVTTSEE-LCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGAS--NQAG 94
            ||:||..::|.|..|||.:..:.. :|||||:..|.|::||||||......|.::.|||  :|..
  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQEA 89

  Fly    95 PYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMI--GANIETIPLAAQSVPARALVKVSGWGF 157
            |  |:|.|......|.::....:||||.|:|...::  ...:.||..........|..::||||.
  Fly    90 P--VVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGV 152

  Fly   158 LTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQL 222
            ...:..:.||:|.:.:|.:...|.|..::.|..:::.||:|||....:|||.||||||||||||:
  Fly   153 TRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQV 217

  Fly   223 AGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVEQ 256
            .||||:|:||| .:.||:||:|...|  ....:||
  Fly   218 CGIVSWGFGCARPSFPGVYTNVASER--VHEFIEQ 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 86/222 (39%)
Tryp_SPc 34..253 CDD:238113 85/225 (38%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 85/218 (39%)
Tryp_SPc 26..251 CDD:238113 87/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C185599294
eggNOG 1 0.900 E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.