DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Klk1c12

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:275 Identity:83/275 - (30%)
Similarity:127/275 - (46%) Gaps:37/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVIT 70
            |..|||...:|   .:.|.|..   |.|::||:......:.:.|.| .:..||||.|:.|.||||
  Rat     3 LQILFLFLSVG---RIDAAPPG---QSRVVGGYKCEKNSQPWQVAV-INRYLCGGVLIDPSWVIT 60

  Fly    71 AAHCVYNKNKNDFKIYGGASN--QAGPYAVIRTVDYIAIRPDFN-----RKTL------NMDVAA 122
            |||| |:...:::.:..|.:|  :..|:|..|.|:.....||:|     ..||      :.|:..
  Rat    61 AAHC-YSHALSNYHVLLGRNNLFKDEPFAQYRFVNQSFPHPDYNPFFMKNHTLFPGDDHSNDLML 124

  Fly   123 LRLNSDM-IGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAE-----RVHSVLVPMWSRAS 181
            |.|:... |...::.|.|..:.....:....|||     .:||..|     .:..|.:.:.|...
  Rat   125 LHLSEPADITDGVKVIDLPTEEPKVGSTCLASGW-----SSTKPLEWEFPDDLQCVNINILSNEK 184

  Fly   182 CVSAFRGIHRITRSMVCAARLY-KKDSCDGDSGGPLVYRGQLAGIVSF-GYGCASA-LPGIYTSV 243
            |:.|.  ...:|..|:||..|. .||:|:|||||||:..|.|.||.|: ...|... .|.|||.:
  Rat   185 CIKAH--TQMVTDVMLCAGELEGGKDTCNGDSGGPLLCDGVLQGITSWSSVPCGETNRPAIYTKL 247

  Fly   244 PEIRDWFQRVVEQHS 258
            .:...|.:.|::::|
  Rat   248 IKFTSWIKEVMKENS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/237 (30%)
Tryp_SPc 34..253 CDD:238113 72/240 (30%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.